SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006319 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006319
Domain Number 1 Region: 335-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-66
Family Eukaryotic proteases 0.00000000299
Further Details:      
 
Domain Number 2 Region: 105-191
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-31
Family Kringle modules 0.0000134
Further Details:      
 
Domain Number 3 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 5.21e-20
Family GLA-domain 0.0000626
Further Details:      
 
Domain Number 4 Region: 251-295
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000387
Family Kringle modules 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006319   Gene: ENSMICG00000006934   Transcript: ENSMICT00000006937
Sequence length 620
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2842:549859:561555:1 gene:ENSMICG00000006934 transcript:ENSMICT00000006937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAVLCSLVHSQRVFLAPQQAKSLLQRVRRANSGFLEEVRKGNLERE
CVEEQCSYEEAFEALESSSATDEFWAKYTACDSVRKPREKLVACLEGNCAEGLGMNYRGH
TNFTRSGIECQLWRSRYPHNPEINSTTHPRADLQENFCRNPDGSTTGPWCYTTDPTVRRE
ECSIPVCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKALSKDQDFSPVQLVENFCRNPDGDQEGAWCYVAGKPGDFEYCDLHYCDEAMDDDEA
GDRLGEDIALEGRTTTKEFQTFFNVKTFGLGEADCGLRPLFEKKSVKDKTEEELLESYIE
GRIVEGSDAEMGLAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEND
LLVRIGKHSRTRYERNIEKISMLEKVYIHPRYNWRENLDRDIALLKLKKPVTFSDYIHPV
CLPDKETVARLFQAGYKGRVTGWGNRKEIWQSSIDEVLPKVLQVVNLPIVERPVCKASTR
IRITDNMFCAGESXXXXXXXXXXXXXXXXXXXXXRPRGRMYENSHVSWGEGCDRDGKYGF
YTHVFRLKKWIQKVTDQSGG
Download sequence
Identical sequences ENSMICP00000006319 ENSMICP00000006319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]