SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008208 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008208
Domain Number 1 Region: 259-306
Classification Level Classification E-value
Superfamily ITPase-like 0.000000000916
Family YjjX-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008208   Gene: ENSMICG00000009016   Transcript: ENSMICT00000009010
Sequence length 307
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3155:32346:50905:1 gene:ENSMICG00000009016 transcript:ENSMICT00000009010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAAAAMSSTPLPLATTSSFSSPNVSSVESLPPHAYSTPQ
PALPPVRPSGPLPFVPPAPVPSVPPLATSVPPSVSPSAAAALSNPPSSHFPPSTSAPSAL
LSAPLPGPPISGFSVGSNYDITRGHAGRAPQTPLMPSFSAPSGTXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVAGNPMGKSVLDKTKHSVESM
ITTLDPGMVPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPV
GYAAGLK
Download sequence
Identical sequences ENSMICP00000008208 ENSMICP00000008208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]