SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009890 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009890
Domain Number 1 Region: 277-334
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.15e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000009890
Domain Number - Region: 234-279
Classification Level Classification E-value
Superfamily ARM repeat 0.000748
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009890   Gene: ENSMICG00000010859   Transcript: ENSMICT00000010856
Sequence length 334
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_747:666943:690624:-1 gene:ENSMICG00000010859 transcript:ENSMICT00000010856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQPQHHHHHHHQQTQPQQTVPQQAQTQQ
VLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQ
VVRAANGAQYIIQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQ
QILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEED
EDEEEDFDDDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKI
HRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences ENSMICP00000009890 ENSMICP00000009890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]