SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000016077 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000016077
Domain Number 1 Region: 2054-2344
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-122
Family BEACH domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 1920-2004
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-18
Family PreBEACH PH-like domain 0.0082
Further Details:      
 
Domain Number 3 Region: 2541-2712
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000785
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 4 Region: 585-735
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000384
Family Laminin G-like module 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000016077
Domain Number - Region: 70-118,468-533,1119-1177,1261-1307,1554-1635
Classification Level Classification E-value
Superfamily ARM repeat 0.000995
Family HspBP1 domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000016077   Gene: ENSMICG00000017654   Transcript: ENSMICT00000017654
Sequence length 2752
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3824:146862:179218:1 gene:ENSMICG00000017654 transcript:ENSMICT00000017654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEPGRAMAASERLFELWLLYYAQKDLGYLQQWLKAFVSAFEKTISLSSLEPRRPEESGAE
VPVLPLDALHVLAEQLDGADLEQALLLLKLFIILCRNLENVEAGWGQVLVPRVLALLTGL
VAELKGQPPPQEGCGTQLENVALHSLLLCEGLFDPYQAWRRQHSGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSLQDADHLPPVLLLRLIHLFGAVLAGGKENGQMAVSDGSVQGLLGVV
RAWGHVPAQDPRLVPLALEALVGAVHVLHASRAPPRGPELRALLEGYFHVLNADWPAGPS
SGSEEALVTLRVSMLDAIPMMLACEDRPVLQATFLSNNCFEHLTRLIQSKLYLQARAPPE
GDSDLATRLLTEPDVQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXAVEGDHSTCPPPPIRNEQPVLVLTQWLPALPTAELRLFLAQR
LRWLCDSCPASRATCVQAGLVGCLLETLSMGVSLGARCQEQVLALLQALGRVSLRPLELR
RLLRPPPGLDSGPGGAEAGKARHAGAIIRALSGMARHQGPRALRYFDLTPSMAGIMVPPV
QRWPGPGFTFHAWLCLHPTDAVLAPAPTRQLQRKQLYSFFTSSGSGFEAFFTAAGTLVVA
VCTRKEYLTMSLPEVSFADSAWHCVAVVHVPGRRPFSQNLVYIYKDGHLVKTAPLRCPSL
SEPFSSCCIGSAGHRTTTTTTGLPTPPVPAAAAHTHPSLTRSQSVPASTGLGWASGLAAP
LQESSISSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQAAAVRSLCALGPNEMAPFKPE
AELQELGGKLLLHYSPQACKNNICLDLSPSHGLDGRLTGHRVETWDVKDVVSCVGGMGVL
LPLLDQVAAQPQEAEAGPAETHDLVGPELTSGHNTQRLLLPLGKSSEERMERNGVAAFLL
MLRNFLQGHAVNQDSLVQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVAAESSRPL
LYLLYQHLLFNFHLWAFSDFAVRLGHIQYMSSVAREHRQRLCKKYGVQFILDALRTHYSL
QREHPLAADDLRTMQTSLLSLAREFLVRSISADGVQVAQVVLSFLVAPGDDGQVVGALDL
LLALLQGSAAQESLAVFLVESGNLEVLLALLVRPRPLPLLHDRVCKILRRLQQNERLPDW
GRQRLRLPDYGLQGLVACLPEGTVSPQLCQGLYKLFLGADRPNLSDLLAVVQLSLQADLS
VRLDICRQLFHLIYKLSDVVRLLAQQAGWQDVLTRLYVLEATTTTAGSPPPFAPEPPTSP
EPALPKPPTESPAEPSDVFLPSGLSCPPEAFYHALSPFCSPFDLGLERASVGSGNSASGG
SSSGTLTPASQPTPSPLDGPRPFPAAQGRHSSSLSNVLEDGSLPEPPVSGDDTSNTSNPQ
QTSEEELCNLLTNVLFSVTWWGVEGTDEAAWRERGQVFSVLTQLGASATLVRPPDYIKRS
LLEMMLESALTDIKGAPVGGLASLTQQALWLLRLLQDFLCAEGHGNQELWSEKLFEGVCS
LLDRLGAWPHLANGTADLREMAQIGLRLVLGYILLEDPQLHAQAYVKLHMLLQTTVPPRR
EEACYVLSKLEAALGRALNTASSKKATEDTAPPHAAAAAAERCSWLVPLVRTLLDRAYGP
LGLQWGLPSLPPTNGSPTFFEDFQAFCVTPEWRHFIDKQVQPTMSQFEMDTYAKSHDLMS
GFWNACYDMLMSSGQQRQRDRAYSRRAFQELVLEPAQRSARQEGLRYSVVLKQQAAQQST
ALLHWGALWRQLSSPCGAWALRDPPTPHWKLSSAETYSRMRLKLVPNHRFDPHLEASALR
DNLGEVPLTPSEEASLPLAVTKEAKVSTPPEELQEDQLGEDELAALETVMEAAELDEQHE
KLVLSAECQLVTVVAVVPGLLEITTQHISFYDGSPERVETEEGLGHDFRPLAQLREVHLR
RFNLRRSALELFFIDQANYFLNFPCKGAGTPASSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDYLSSRPQEMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFP
WVLQDYVSPTLDLSNPAVFRDLSKPIGVVNPKHAHLVREKYESFEDPAGTIDKHYGTHYS
NAAGVMHYLIRVEPFTSLHIQLQSGRFDCSDRQFHSVAAAWQARLESPADVKELIPEFFY
FPDFLENQNGFDLGCLQLTNEKVGDVVLPPWASSPEDFIQQHRQALESEYVSAHLHEWID
LIFGYKQRGPAAEEALNVFYYCTYEGAVDLDHVTDERERKALEGIISNFGQTPCQLLKEP
HPTRLSAEEAAHRLARLDTNSPSIFQHLDQLKAFFAEVVSDGVPLVLALVPHRQPHSFIT
QGSPDLLVTVSASGLLGTHSWLPYDRNIRNNFTLSEDRRMGSHXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGGLSVGLAPKPVQVLYGHEAAVSCVAISTELDMAVSGSENGTVIIHTV
RRGQFVAALQPPLVTLPGPVSHLALGSEGQIVVQSSAWERPGAQVTYSLHLYSVNGRLRA
SLPLAEQPTALAVTEDFVLLGTAQCALHILHLNKLLPAAPPLHMKVPIRSVAVTKERSHV
LVGLEDGKLIVVGAGQPSEVRSSQFARKLWRSSRRISQVSSGETEYNPGEAR
Download sequence
Identical sequences ENSMICP00000016077 ENSMICP00000016077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]