SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383501326|ref|YP_005414685.1| from Rickettsia australis str. Cutlack

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383501326|ref|YP_005414685.1|
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000144
Family Apolipoprotein 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383501326|ref|YP_005414685.1|
Sequence length 153
Comment hypothetical protein MC5_02300 [Rickettsia australis str. Cutlack]
Sequence
MKKVLITLGATATLLLTPSIFADSPTKEEAKANAVQTEAVVTTSIKTITENLKELKDNLT
NLAQTGADTFNQTLSNTYDQITQSVAEIKKTVKDQKDKKGEELQKCIEDVKAKMENYKKA
ESKEQEKIRQHLVDKLEELNKNINEYNKEKANS
Download sequence
Identical sequences H8K6E9
WP_014412377.1.17962 WP_014412377.1.98329 gi|383501326|ref|YP_005414685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]