SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383501828|ref|YP_005415187.1| from Rickettsia australis str. Cutlack

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383501828|ref|YP_005415187.1|
Domain Number 1 Region: 196-355
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 1.23e-64
Family RalF, C-terminal domain 0.0000347
Further Details:      
 
Domain Number 2 Region: 8-192
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-54
Family Sec7 domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383501828|ref|YP_005415187.1|
Sequence length 646
Comment hypothetical protein MC5_05290 [Rickettsia australis str. Cutlack]
Sequence
MDSLVKNAVMKLFNDKPKSGIVRIKQWCADNNKDFAEETAKFFYEEKSNLNLECVGDYLG
TDGGDNKKVLESFTKQFNFKEKDYLESLRGFLQSFKLPGEAQKIDRLVESFGTNYYEQNL
NGEIKSKDAAYILAYQTIMLNTDLHNPSIAEPKKMTLEQLKNNLKGTNESQNFNDNFLKK
IYAGIKAKPFVLNFVDSSPGYEIDNISSQNDQTFKKLNKFLKETRNIQDSFSKLQNNNLT
AEFKNPKTLLNKFTGYEGSVIVKDEKGGKAAIQVYTPSVFSRWFLGEKSKIIIQPLSEEG
KQPSEQSLKLAAQITASFDTKVTSIKATYDYLKEDLKSRYENIINPKQELERASSIAELH
KNIKEITAIVQQTNQQIPEKPLASKESFEDLTQAEIGIKPVEILIKSSSQPVEKPKFNSF
IEELAWKSVQRKQNIDTPISQNKEPKIQTDNHAKILEELKQKQKELEDKKKGLEEKKSNS
NITREERWKIVAELESINNQFKAIEKVYNTINSAADREKKFDNKNNPASPTKGEPTAADL
QQQGALAAIKRMKEEKIKQQQAEAVNQSSKNTPTMPSGTIPVPPPMPGSGLPVSPPPPSI
PNIVKKEAKDIGKQIPQEGDKHKEGLAKAMEAQRKKIEQQNSGRGM
Download sequence
Identical sequences H8K7V1
gi|383501828|ref|YP_005415187.1| WP_014412868.1.17962 WP_014412868.1.98329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]