SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Picst3|33562|fgenesh1_pg.C_chr_7.1000351 from Pichia stipitis CBS 6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Picst3|33562|fgenesh1_pg.C_chr_7.1000351
Domain Number 1 Region: 117-416,451-502
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.36e-80
Family IF2B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Picst3|33562|fgenesh1_pg.C_chr_7.1000351
Sequence length 505
Sequence
MTEENKANIKAEGSTASTGAGSETAANSGEKVLSNKELKELKKKEKAAKRAAQKEAIGIS
PEQQKQNAEQKIDKRKNQTATNTNLKKQLDQTVIKDGAKRIPSLFSHLETREQRNALSPS
ISHIVHPAILSLTLKYSTYKVVGSTSRLRNMLQVFKIVIQDYHTPENTTLTRHLSGHLSH
QIEHLKTARPLSVSMGNAIRWLKQEISHISIDTSESKAKETLCSKIDDFIHEKIDLSDRV
IIENASQHITNDCTIMTYGHSEVLEKLFKYCVIEQNKRFNLIIVDSRPLFEGKRLLSNLV
STNYHPEIEESESEVHYVLINALSSTLLEDVDCVFLGAHAMLSNGRLYSRVGTGLIAMMC
HSRNIPVLTCCESVKFSDKVQLDSVTTNELADCEDLVHSINSKKPPQKKSFAMEQFIKQC
DEEKASNNKNNKQQQQQHKKKEGSAEPEQESDEAPLKDWKSYPNLNILNIMYDLTPPEYI
KKVVTELGALPPSAVPVILREYKNT
Download sequence
Identical sequences jgi|Picst3|33562|fgenesh1_pg.C_chr_7.1000351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]