SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|202713|fgenesh1_pm.1_#_385 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuC3|202713|fgenesh1_pm.1_#_385
Domain Number 1 Region: 1967-2061
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000934
Family Filamin repeat (rod domain) 0.0041
Further Details:      
 
Domain Number 2 Region: 794-883
Classification Level Classification E-value
Superfamily E set domains 0.00000000000207
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 2577-2665
Classification Level Classification E-value
Superfamily E set domains 0.000000000012
Family Filamin repeat (rod domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 469-556
Classification Level Classification E-value
Superfamily E set domains 0.000000000187
Family Filamin repeat (rod domain) 0.0062
Further Details:      
 
Domain Number 5 Region: 2793-2874
Classification Level Classification E-value
Superfamily E set domains 0.000000000287
Family Filamin repeat (rod domain) 0.0091
Further Details:      
 
Domain Number 6 Region: 2201-2282
Classification Level Classification E-value
Superfamily E set domains 0.000000000934
Family Filamin repeat (rod domain) 0.0067
Further Details:      
 
Domain Number 7 Region: 1024-1119
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000112
Family MgtE N-terminal domain-like 0.0048
Further Details:      
 
Domain Number 8 Region: 3421-3518
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000000218
Family MgtE N-terminal domain-like 0.014
Further Details:      
 
Domain Number 9 Region: 4561-4660
Classification Level Classification E-value
Superfamily E set domains 0.0000000038
Family Filamin repeat (rod domain) 0.004
Further Details:      
 
Domain Number 10 Region: 1640-1720
Classification Level Classification E-value
Superfamily E set domains 0.0000000153
Family Filamin repeat (rod domain) 0.0097
Further Details:      
 
Domain Number 11 Region: 941-1018
Classification Level Classification E-value
Superfamily E set domains 0.0000000153
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 12 Region: 375-477
Classification Level Classification E-value
Superfamily E set domains 0.000000167
Family Filamin repeat (rod domain) 0.015
Further Details:      
 
Domain Number 13 Region: 279-346
Classification Level Classification E-value
Superfamily E set domains 0.000000347
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 14 Region: 2106-2193
Classification Level Classification E-value
Superfamily E set domains 0.000000487
Family Filamin repeat (rod domain) 0.011
Further Details:      
 
Domain Number 15 Region: 571-669
Classification Level Classification E-value
Superfamily E set domains 0.000000667
Family Filamin repeat (rod domain) 0.0092
Further Details:      
 
Domain Number 16 Region: 3140-3230
Classification Level Classification E-value
Superfamily E set domains 0.000000734
Family Filamin repeat (rod domain) 0.0081
Further Details:      
 
Domain Number 17 Region: 1877-1977
Classification Level Classification E-value
Superfamily E set domains 0.000000934
Family Filamin repeat (rod domain) 0.017
Further Details:      
 
Domain Number 18 Region: 2295-2384
Classification Level Classification E-value
Superfamily E set domains 0.00000302
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 19 Region: 4349-4439,4525-4553
Classification Level Classification E-value
Superfamily E set domains 0.00000374
Family Filamin repeat (rod domain) 0.006
Further Details:      
 
Domain Number 20 Region: 2697-2783
Classification Level Classification E-value
Superfamily E set domains 0.0000038
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 21 Region: 1134-1226
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000837
Family MgtE N-terminal domain-like 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|MicpuC3|202713|fgenesh1_pm.1_#_385
Domain Number - Region: 3944-3990,4030-4068
Classification Level Classification E-value
Superfamily E set domains 0.000113
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number - Region: 4679-4766
Classification Level Classification E-value
Superfamily E set domains 0.000127
Family Filamin repeat (rod domain) 0.019
Further Details:      
 
Domain Number - Region: 1758-1841
Classification Level Classification E-value
Superfamily E set domains 0.000483
Family Filamin repeat (rod domain) 0.0083
Further Details:      
 
Domain Number - Region: 3263-3348
Classification Level Classification E-value
Superfamily E set domains 0.000634
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number - Region: 3844-3926
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0017
Family MgtE N-terminal domain-like 0.026
Further Details:      
 
Domain Number - Region: 4466-4552
Classification Level Classification E-value
Superfamily E set domains 0.00229
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number - Region: 3740-3821
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0123
Family MgtE N-terminal domain-like 0.029
Further Details:      
 
Domain Number - Region: 2907-2975
Classification Level Classification E-value
Superfamily E set domains 0.022
Family Filamin repeat (rod domain) 0.016
Further Details:      
 
Domain Number - Region: 1500-1582
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0641
Family MgtE N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|202713|fgenesh1_pm.1_#_385
Sequence length 5603
Sequence
MVSGVMRSLKGWKADKYQFDVRVHHLFNVLPNTKSLCVTWKRGKKSSSSKSVAVARGEAA
IDDNLQLLCTLFVNPKTDAYAPKVSSFVVKEGDKTYGEAALDLLDFAITPGRSVKRVLPL
KLGKKTLATRLVVSVTATPLAEGVAPSEASSVASALDILERGDISEKEKNQKENAGGGEL
TQVVEVETEWRGERGDRDSESRESASASGSGTPPRARRPPRSLGGALDDLALATRPDQSV
AFGSDKITGDALLDLSAQPASGPFAGHLSHVRDATQRMRLLVGRACKINVSAADYYGNPR
SSGGDDIGGNVRVSDHGDGTYGLEFTCTSQGAWTLRVMFNGRLANDSYELIVSYGPLTSR
DLRASMTKKKGGRQQSVCGGDDELVVEVIEKRTGRVLTGGEAFAVRVVSPSAMSMSVPLR
IKPGTQSASARITWPEVGAHAVTVALDGVPIDGCPIMVAVHPEKMRLGACQITGAGTHRC
VSGERISFVIDAHDSRGNRLVSGGADVQMRTRVIGGADDGVVKEGSVLDYGNGAYECSYA
IRQAGPYEVTITLDDETLTLQGICVPGRAVASQCVLLGDAVLEVEVGERGTFQIERRDAH
GNQTPSRQSQLAIRCAAEGPGHIDAHVVDGAEGHASIVASATTSGRYFLHVTAGEQQTPI
VGSPFELVAYPSSAAANSCVTTVYGASLASADSDVLTATAGDVVKLVVSPRDRDGNPTVF
SPEAEASASARGGDKGWTKSDADDVIFENDAKSALSPATLQATFSRAGSYLLDARIGKDH
LAGYPRMLQITPGPAHPLRCVLFGDALDGVDANATSTLTIHAADRHGNLLARGGDLVDMS
LLSPDGVGTVSAVVVDHGDGTYGASFALDKAGVWGLSVSVNGVKGAGDVAEVVASFGPCF
AHDVVFRGFGVDPGAPGTGGSGGSSSSSSFDATSVMTSSDVVVQASAYESLNRWMTGSEA
VGVRVLTPSGGISAVDVTFREGRYHGSYRWTQAGLHTVSVSLDQEAVIGSPFTIDIVNAL
PELRELEDMSSSEVSAFLVRLQPEAASQALASMPPTRAAESLEGYSAESTTKMLNGMYPS
AVSQVLNSLPRDHAAAAVEGMTEERTEAILASMDPADVGALLSNMSGDALREKSSAIARS
MNKMNDADLGTLLSAMARSEEQGGAHADATAKILDGVATEKLSRAVDGMSTEEGAELLRR
MNPDKAAAVIAQMDPMLQIEFMKTMDDYAVFALTKGLYKQYKEDKHLPAKERDAEKEAAV
IRARRIGPALGRLHPEKLATAVSAHAAEDLGGTLYTLLSEPAGGHIRHAAAAAEAAAAAA
PEPEPAKGKKGKKSKKKEKATPKPGAILDAQKLDETIAAMSMGARSAAAQLLRELPMEKQ
KEVAAELVDCCPKGVAGAIFADFSGHEMMRMMMHFTPEQLARALAELARESIEVVALLQE
SYKPSTRVGAALSVIVASLNATDGKFELTRPEKFAILKGAPGYVLKHVKPLRDLGICCVN
HLTSEMTALVLSDLDVRSCAAAFEGLDPDQVRAIMEADRAEGELGQGHSHPNLIAACVRY
MNNMSAKDAAGMLEAMPLDLATEICINTLDKRVEEIFGFIKNSKLRSRVASRATISLIAS
EVMFPEAMLGSDVASESIATENVDAAACGTEYAFKLVARERGGGRIRHGGAELTAYVSPP
IGHPKADFGEPCVVTDNGDGEYDVRFTPTVSGTCRITLEVQSAELDRPESREILIEIEPG
EPVATMTEYDATAIASAWSAGEPGVLDVFMRDAFGNVVHADKALFAFEGRAEGPGGVAIE
PTVTADGVSRFEFTTTIAGIYSVSVVSPDTGEPLPGMPLDVVLRPGPVSHVGSTASLATE
TSAGDAAGARAATHGVTVAIAGEEITCHVSARDRHGNAAAWNGEKATAVARGSGGSGEFT
FDAIDVGGGRAELRGVVPRAGSYLVAVAVDDLEIASSPIALVVYPGQCETSRASIRGDAL
AGVFRDAPAHVTVQTEDKFGNPCHVGGDQVDVSLTAPSGARLATIDVVDHDDGTYGCTFI
LDEVGRWIAQAVVNGRVAKESTSEIVATYGPLRPRDVALRPGPGLAAAFGGGGGSDVGVG
SDWNAAVVCGAVNDVYVQSLEYEVTGRGMRGQEAISVHVVAPSGTSHAVPTSFTESGGRY
RASVRWWEVGTHEIVATMNGESIAGSPLFVDVEALDASLPMSRLSGAGLETAIAGEPALA
LIESRDSRGNRLFEGGANFQVATRVGGVTTKGTVVDNGDGTYEASYVVTKAGPFEVSFFR
GTETITFRATCEAGAVDYNACRVEGALRTRWQAGGTVALTVVRVDAYGNRVPRREGLARL
AGGGRGPGAVAVDVSELGDGTCEIRFFATVAGSYQVGVFVEDEDTRAKRDSADQIYETEA
ELEEALLNGEIDAEGFDAYGDRRDGVSKVDDSLIDPVRLNRDLFGFRANTMFPLPNGIFE
LELGAADAEPTNVDVIVVGATRAGETWIVHAGDEIFVQIQARDRYGNRSFWEEDKHIEVE
ARGTEYVAFNVTGATGNREDYVARMIRSGTFELRVLADSLAVSWRALQVIAGPTHTPMCR
LSVNLLETVRTGDRVELVLKTADMYGNLRLEGEDEVSIEVTGPNGVKARDARVLDNVDGT
YGLEFVAPTAGRWNILVMVNGEPTVDGGIPFTVLFGRLTAEEASARLIPSIEDADGVYEI
GSTAKLVIEGVGFRESGRLLTGGEAVTVRLLQPSGVQEAIPCAMTKDKQSYVADVQWLYP
GRYGVSVMLDGEHVPGTPMYVTAEGLEVSLTSSTFGGRGAEFCVAGEEATVTCEARDYGG
NRINRGGAPLLLEARTPDGEVILGKTVDYGDGTYEFTYTVTKAGQMEIAIILNKPDHPTT
RTIPIPCHAGPMSPPDCDVDAAKMMARWVAGAPGAVRVARRDRFGNLTKNRGRLNRLGAE
VEGPGPCDCENVELGDGSWEVRLRAATAGTYDVSVIAIKYPPNASDDPDDRAVVGSFQVT
LEPGPTFPSACVARMALLTVDEETGETIEEPIGGKEEDLDTADADADDVDVAAPATIMAG
DVVIVRVLPRDSFGNKTSWTGGERILAAARGPVEVGFEPMEDVGSFKSTLTAAGAYSVAA
LVGDCSCAGWPRLVRVVAGAPDPCKTTISGDGLGHCTTGVPVELLLQTHDAYGNPRAVGG
DLVELFGAPANEGGRREAAVDDAGDGSYRAKIILEELTQYDLIVAINGLRCKDEAALARY
FLSPTLGPLRSSECALRGAEDVVNLGDATTCVIQPTDAIRVMTGREAVVVSVSTPSGLTY
NNRVRFNAETRRFESPAFWVEPGRHLVRATLNGVPLPDVPRLVRVRDANGWLEEEDTTEI
VETAEVIDDEDSDGIGLLKGAELDVAQIAEVTSEDAEEDAAFEFGGGGLRPSRAAAQRAA
KSLEGLDASQVAKAMEDMRPAAAAGVLNEMPMAERVGALSAMDPAAAAAAMCCMTTTEVT
TTFRAMDKKTRLDVFANMPANARGALLSSMSAQEAHDLILRDLWNTDPDAAVESVAHMDP
DAAARACLLMPPEFLERVLAVVDAKKTGGPLLRALQDLTPEGPKRSTLALVTLAERPMLE
KVASHLAAMSQASVDELVGGEVGGTGPRLAKLVGSLCGGGGSIPAASSGIAGAVLPKMSA
KLAGHILCLLGPGGSARALASVVELSGYNGAFGAAMAEELDETGWAPDAPETRADVQTDA
VVDVFLSMAVVDDNSDAYPDQAVVVLAAMEYSLTARVLGNLPPSESAILASRMPDATVVG
EILASMPTNKRAMMMVRMEFAAGSAACDAMEPKDVASAFAAVVETVLDEKTQTRAKTELK
LRLVAIISEMDPFNAGAAMMEMDPLELAATLAGWLAPEKFAAIIASGSMDMTFVASVLDD
MDADRADRVVAALPPAVAEVLLGLLKSGELVAMAKARGVVSLPLSTIAGTNASECVAGAE
AKFSLISANPGGGRIERGGARVRFAIFEPERDDATPTATAMAMAPATAPDASRDASDDEE
GFPVLEGHVATSQGGEMVDIGNGTYDATYALTRAGTYRVVLTTAGQEISFPIECVPTTLD
PPSCEIIAPSEEDLEKWTAGSWLEVRVRRRDRFGNVTMLARGGGGGGASAGKRSKKRHGG
GGGGGGGGDDGLVVFADGVGAGDVEAEVVEPTDAEVEENGVDFAVARFRATVAGEYELAI
FAADAASDAYGSRALDLLPGSAALKSVALKPSVADAGKSTVRIHGLREKRGRVGGSTLVG
DAGQEVTIAVEARDRFDNLAAFASSEGQRVRCDAVGPVDLTLDVTTSTSSELVFKGTLAR
AGSYRFKTTIDGRNVAGWPKALQIVAGVADAERCVVRGDALAHGVKVNERSRACFVAHDA
HGNACLEGGDRVLARLFFVPTEEDPDDADDARHERRGGAPPPADADVVDHGDGTYGLEFS
LPRPGTWSMYVNALLGGPGGVPDAARLRVGAETKAYVQAIDFDAVGRAVGGREPVCLRLL
TPSGVSAIVPIKLTKGGERFAGKVCWPEVGEHVLSATVDGEAVAGSPLRVRVAAADAHLP
ACKALGDGARACVAGVETQFVVEARDARGNRLTAGGASLTLRVESPVGGGGGGGGGGDDD
DESESAIDSTQRGSVLDQGDGTYLASYAVDRAGPYALVVTSKLHPGARLRLLGSCAPGAV
DVSRCHVDAGEMRRLVAGERGVARITRRDAHGNAVGPGPDLLPFRVDAASGPGPAEVDVV
ETGDGGAEIRFEAKIAGKYALRVYSGYARDRSAYRPFDVIVLPGQASASSCVAELEGTRA
HGPGVVAAIAGESLTVRMRARDRFGNPTRWKRWQKLEVSAMGPADVGRVSFTETSPEGYV
SEDDDDVGLDGNGAIVAVSSLATVGGGRGAFVATLERAGSYVISCAVGGQAVNGWPRVLR
VVPGEVDADYSTWRADAETMAMTSELTIASASANAVGLGLDRRLVERDDREALALRKEAD
ALRKRLAKYEEAAAVVMEAATLSGRSLKEHARDAAYIAEAKENVIDNSASNRSRSGSMTA
MTSTATVANANAVRGSLRDDDDGGDDDYRPPPGGGGGAKKRSGTAATAAVAPTRSRSSLA
EAFIALNAKARAKAREEAIIALEAEARTVAKERNEDGKRTRAAAVEEDSKSDATIMAAMK
KVRGFNKHAAASTPRPRDTPRPRCPAEAKAHKAAQIAAKAAAARPDDRDPENHSRNRDVD
RDHNLWGLAPDGVAIDAPPRDAHALQHAYAPEEDFSDCALPKLELGGDDDAALAAAADAD
ADAEKEEEDPWPPSSPSGGSTRGGTATAAVSAFRPRLSITRDIPIAPTRHHGHGTMAKAT
HDVIEIVSESSVVSVTRCVNLAREGVVGAGVEVSSYASPSSLHADVAARLHAELKASDAN
AANANANAADANAADVGAASALGRLVARAVRCRCPDVYRVVVSVRAAPKTTRGDDTDTDT
DDGDDDDAGSDAGAGAAGVNVKVRLPVAAPSASRARAARHVEERYAVAVAAENWKVAVDG
VAHAVEFLKACETGEGLAALEYESECENQSRGVCGGASASARSASASEEEDDFFDRAAAA
SWAATAITAQELETFLDHGALSG
Download sequence
Identical sequences jgi|MicpuC3|202713|fgenesh1_pm.1_#_385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]