SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|57056|MicpuC2.EuGene.0000040182 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|MicpuC3|57056|MicpuC2.EuGene.0000040182
Domain Number 1 Region: 538-616
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000881
Family Calbindin D9K 0.041
Further Details:      
 
Domain Number 2 Region: 673-748
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000126
Family MgtE N-terminal domain-like 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|MicpuC3|57056|MicpuC2.EuGene.0000040182
Domain Number - Region: 223-305
Classification Level Classification E-value
Superfamily EF-hand 0.0053
Family Calmodulin-like 0.019
Further Details:      
 
Domain Number - Region: 38-47,316-421
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00575
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|57056|MicpuC2.EuGene.0000040182
Sequence length 851
Sequence
MSSSSAPAPPPPATHSPDGQKICYEETTTPPEGWIFPPPPASPPPPPIGTVPPPPWNAPS
PPPPLPPDPTLNLTGSGSGGAVTTWTIVVPCPAEEEVAAGKALIFGFVDGENPYQLAAFV
LFWIVGFALLVRRYYVKWAKRRADRIVTFEIACGRFVNRGLWSAKKNFDNYLRERDDAVA
EAKLAKEMAKMKGKKNKKKRQRRKKKAPPPREPIPVPMQTFFDSYRLVEDPARWRSRLRV
VLDPEDTDAVTFRSFVVGLGALGTGVFERVGSDYVHPKFIFTFGLLDPTRAGHVSRDDLL
KLAWRFVKAKEKKWKLDVDESDDEDDDGGAAADEKDKKPKFRKLADVEDIEEVGERAALE
RRRRDHVKIYVSDQNAMKLKGFTTDGSKPDEEVEDLDAWTRVNPLKTEKQKRRSARDRAK
IEKRMETRKRLRKAVTTLRDEYRERVDLSDFARLATALPQPFKPAFRLYDALKKYVKPAT
RVVAEVPGLALDERRVADEVDQWVRDQKPAWFFDDPRTIKRRRREDRDPKLLEELAHMTR
KPSSDKETVRDMFDKYDEDRSGGLDVEEVAYALGDLGALDHVLASWGSVEEIFEEFDDDQ
NGTMDFTEFTTMINKIKQLKRKAEGEDVQEEAAVEIGDESKLYVVDLNGKRRPPRPPLGP
KIGGRSQAVRINARYRVDSLLTMPPREAVETLSKVSERARVLALNMLKIKNAAEIVYVMP
PRQRAELYPSLHPDVELEVLSMLKHPERVRKHPTELRTFVDRQAVELPGSVGGASGVPAF
LTAPPVRFPDEDELDSARETTTRSNSSSNDGRGRARGDAYAVVDVGEGGSESESEDDDGL
DEDGRFRYHIV
Download sequence
Identical sequences C1MPV7
jgi|MicpuC3|57056|MicpuC2.EuGene.0000040182 XP_003058016.1.6386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]