SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|MicpuC3|69428|MicpuC2.est_orfs.6_8411_4276205:1 from Micromonas pusilla CCMP1545 v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|MicpuC3|69428|MicpuC2.est_orfs.6_8411_4276205:1
Domain Number - Region: 66-132
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0549
Family DmpA-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|MicpuC3|69428|MicpuC2.est_orfs.6_8411_4276205:1
Sequence length 205
Sequence
MGLLTKLVGVSIKQGVLMAIIAALPWWWFGYAGLTEADLENPAKFAEASVMMSLGLVLFV
GGLAYRGLPFDLIPDWIPLFGKLDDLAAGGVAGAGCAMMYFGWHYGTGPKPTEAIAVANA
LAVANAHLAPAKKAAIAAIKAFYAVAKPIVQQLAPHVEKVYSEKALPLINAARAKIMSGA
YEEYLLQLAANNPGFFGKLLGAKAA
Download sequence
Identical sequences C1MU05
jgi|MicpuC3|69428|MicpuC2.est_orfs.6_8411_4276205:1 XP_003059412.1.6386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]