SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00003139001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSPATP00003139001
Domain Number - Region: 45-122
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00188
Family KorB DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSPATP00003139001
Sequence length 201
Comment gene=GSPATG00003139001
Sequence
MFNTQKIEKQRRSKERFVYEACNLVQQWRDLFKNGYTDYAGNFIKPTLKEAANLIGCSKK
TLEDYYSIIRKASQITDINQCLQKKMGHLRQLLRQKEENLNVAAPIFQEVEEKNPSNDSW
NNLIIEADDENQEDPNLNTDRYFIETPIECERSPIQYEREQQYDNEYSHTEINSNQYWKE
IQFEEENDMAIANQEQVFFDF
Download sequence
Identical sequences A0DYQ4
XP_001455568.1.48737 GSPATP00003139001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]