SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00011822001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSPATP00011822001
Domain Number - Region: 42-121
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0471
Family KorB DNA-binding domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSPATP00011822001
Sequence length 131
Comment gene=GSPATG00011822001
Sequence
MDNEIQIHNKVKRIKERYVHEAMLLVEHWRSLYQQPYLQNGRQLKITLDKAAEIVGIPRK
TLEDYYYQLKKAETLVDLQNFKNCKIGVIRRIVKESKKQSETTTHLIDTNEFFLQENETI
VNRKNSFEYDD
Download sequence
Identical sequences A0CZN2
XP_001443646.1.48737 GSPATP00011822001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]