SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00012235001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSPATP00012235001
Domain Number - Region: 42-100
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00131
Family KorB DNA-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSPATP00012235001
Sequence length 188
Comment gene=GSPATG00012235001
Sequence
MDQPRHVFKRVKERSIMDAKLSVDEWRNLFKNGEIDQNGNKIKYSLKQAAEKVGVPKKTL
EDYHQLLKKAEQMVDLNNIWDQKMGFLRKLLKCKQQQQFQSQIFSDEEINNQIQEENEVQ
EQESEQFNIDEMIVVGDVQYYNVDEQFEFVQQHVQTVEVHHQINNDKKMEIPYSDCDDCE
TDDEFDNE
Download sequence
Identical sequences A0D0W6
XP_001444080.1.48737 GSPATP00012235001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]