SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00028049001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  GSPATP00028049001
Domain Number - Region: 42-100
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000432
Family KorB DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00028049001
Sequence length 122
Comment gene=GSPATG00028049001
Sequence
MQQQQQPRQRTKERFVSEAMNLVKLWRQVYQTETKFVDGRSVRITLDQAAEIVGCPRKTL
EDYYYLLRKAETLVNLEEKKNEKMGYIRKLCRENKKYKQQLKQEEECYQLNQFQFDDNIH
DD
Download sequence
Identical sequences A0BEP9
GSPATP00028049001 XP_001424414.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]