SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00031638001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00031638001
Domain Number 1 Region: 46-108
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000445
Family KorB DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSPATP00031638001
Sequence length 125
Comment gene=GSPATG00031638001
Sequence
MQQQQQQQQQPRARTKERYVFEAMNLVKLWRQIYETETRVVDGRTVRITLDQAAELVGCP
RKTLEDYYYLLKKAQNLVNLEERKNEKMGFIRKICRENKKQQQQLQQEEEFYQINQFQMD
EIHDD
Download sequence
Identical sequences A0BS90
XP_001428805.1.48737 GSPATP00031638001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]