SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00012538001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00012538001
Domain Number 1 Region: 99-307
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000183
Family Tropomyosin 0.0036
Further Details:      
 
Domain Number 2 Region: 296-505
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000575
Family Tropomyosin 0.0096
Further Details:      
 
Weak hits

Sequence:  GSPATP00012538001
Domain Number - Region: 487-600
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00418
Family Myosin rod fragments 0.0058
Further Details:      
 
Domain Number - Region: 663-760
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00706
Family Fibrinogen coiled-coil and central regions 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSPATP00012538001
Sequence length 1069
Comment gene=GSPATG00012538001
Sequence
MSSYTSRYRPSTLGSSGINQNQAATTQSSYRTQVTTTTTSSNLSVPQTNTTSTFERSDGR
RSSTIKAPPATAVQMAPPSGERKWLGKYPEVVCFLLALENDRVMRENDALIKRIKELESQ
SEGGDVRVRELQAKLDQANRDITQYKSDIDKHLIRIKQLETEIADYKSRLGQVDNSLAQR
LKDAERKITDYERDINQWKSKYSTDKSSWDSEMKRLQDLLSQRQRELDDLKNNSGRNLDG
LQKQIRDYEVRIRDYENKFNTLQSEIDRLTKLLNERNAENDKLKNDLKNKLLECDDWKNK
YNTLQQQFTSMKSQYESKINDLSNQLQQRDRDLNDWRNKYSTLENKYNNLGNQQNGSEQK
LNQLTQLSQQQVREIDRLNGLLRDKDAQNNSLKEKLARAEQDNKNLLDQINQLNQMIKQL
NREIEKLQGDLNGRINEINYLNQQLQKCNDNIRNLEDQINKLNDDIMNNRDEIMSLKSQN
EQLNNKINELNERAGQQQGDLHAANSEREERELTIKQIKEQLDQLLTDKQILEQQLNDLK
NALQQKNDDISRLNQQNKQRLQQLMDLQKKCTELEYTISELRGVELKCKLLEDKINEYQK
LIDDLKRRVAQQDLQLLQAQANERRLQDQDILIQNQAKEIQRQNDQITSLLKENDQLQQQ
ILQLENEINKLKSLENYVTDLEKQLQNAQDELNKLKQLLDSRTQDLNDWKLKYQQLQPLE
DQYRVLEERYKQAEQRVQQLQNDIEKLNKIIQQNQIDIDTHKWNLNQQEMTMKVKDDALE
ALNERMGNLVHDYEEERKKTQDYEQLLAQHQQNLDKLAQAQTQNNNLQSDLNNANKDIEQ
LQSENNDMRQDLQELERQIQEFKQNEARYKDIENKFNQQLKDIERLTEQLREKTHQYDEL
NSQFGALDLQLQQANQTIDELNKRIAELEQTKREHEVLKTQTDQLDNLNKQYLADLDRLN
AIVNQRQKELEELRQLMQKLEDRIAYLTPFEEKFQVISPKYQESQEIVERQKEDINKYQE
QLNTVDELNKKVQDCMMILTMQFTECEGLRSQLDEKDNLIANLQQQQHQ
Download sequence
Identical sequences A0D1U6
XP_001444410.1.48737 GSPATP00012538001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]