SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00026739001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00026739001
Domain Number 1 Region: 192-433
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000000654
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 2 Region: 384-633
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000024
Family Tropomyosin 0.0028
Further Details:      
 
Weak hits

Sequence:  GSPATP00026739001
Domain Number - Region: 711-807
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000497
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 87-213
Classification Level Classification E-value
Superfamily Tropomyosin 0.0235
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSPATP00026739001
Sequence length 931
Comment gene=GSPATG00026739001
Sequence
MSYTSRYSSARPQTVKSQVETKPTTTPTVQVTKPADQSPQPVQRSDVRRSSQLRASGQPT
VINVPPPTTERKWLGKNPEVVCFLLALENDRMMRENNAQFNRIKELEGVNEQQEIRIREL
QTKLDSQTTEISNYKLKSEIEKHIIRIKQLESELNEYKSKLGSVDQSLAGRLKEAERKLQ
DSDKELTNWKNKYNTDKTNWDNEIRRLNDLLAQKQKELDDYKNNQGKNYEQLQQQLRQYE
TKIREYESQISTYKSDIDRLNKLLLERNSEIDRLKTELKTRLQELDDWRSKFTNLQNQFN
TMKSQYESKINDLTNTLQNRDRDLNDWKNKYAKLEGQFNNLGSLQSGSESKITDLQNRLS
QLQSDFDRQATQLRDRDAQIQALKEKLQRLEQDNFTLNNQLQDLQSRYNNLLKENEKLQN
ELRNRKNELDFMKQQLQQANDQLKRYEDQINQLNEQIMECKDQIMALQNSKEMLERQLQD
LYAKSNDNVGELKSANDQLEGKDKDIADLRDQLNQFQVDRQIMESMISSLNNQLANKNDE
IQRLLAQNKLRLQQLLELQSRYAQLDYLLSDLKGVELQNKQLIARINELTQLVDDLKRKL
AQQELQLLQSKSNEFKIQELESIIKELAKEIQRLNEFLNQKLTENDKLNMQIISMENEIN
KLKNLEPLLRELEKKLQTHLDDITRLKQLLDSRTNDLNEWRLKYSKLEPVIDEKRQLEEK
NRLFENRIQGLQQDIERLTKQLRQKQLDIDQLNWILNQTEGLLRNRDDSINSLETRLNNL
QRSYDNERQKTLNFEQIQSQLQQALDKINQLETQIKGLQNDLNRAKKEVTYQQNENDQMR
QQIAKEEITILDLKQNEARFKEVENRLNQSQKEVEKLTRQLNDKLQAYEELKQNNGLLDT
KYKNLQQQYQGNYYGEININQNKINNLILNS
Download sequence
Identical sequences A0EGH4
GSPATP00026739001 XP_001461788.1.48737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]