SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSPATP00029381001 from Paramecium tetraurelia

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSPATP00029381001
Domain Number 1 Region: 197-417
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000327
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number 2 Region: 425-635
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000183
Family Tropomyosin 0.0038
Further Details:      
 
Domain Number 3 Region: 779-978
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000523
Family Tropomyosin 0.0072
Further Details:      
 
Weak hits

Sequence:  GSPATP00029381001
Domain Number - Region: 611-782
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.0039
Further Details:      
 
Domain Number - Region: 89-214
Classification Level Classification E-value
Superfamily Tropomyosin 0.0562
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSPATP00029381001
Sequence length 981
Comment gene=GSPATG00029381001
Sequence
MSYSSRYSSSISSTVRSSGIGGATTTSSQYSSTNTTEAPQRSSTQRKSVLVKPQQEVVNV
PPPSKERKWLGEKPEVVCFLLALEVDRLQRENSDQRAFINELQGNYSKLQSEYTTLQEKY
NLEVQQFKTTIDQQNVKIKALEDEINQYKSKLGQVDNTLANKLQQAEQRIKDLERQLKDQ
ESKYTTEINNLKSTWNTEKSNFESDIKRLKLEIENYINEIKNLKGNSSSDIDRLNKRIKE
LETQISEYQLKIKNYETQISDYQNKLREWEAKGRDYDSKIAQYQSELDNLKNQLRDRDSE
IERYKRDLDDWRNKYSALEMQFSNYKSSSGGESERLNGLLRDRENDINRLQSELRNTIDE
WTSKYTNLENQYRQAQSEIDRLNGVVRNLDDEINRLRQIIDQMQREIDDWRLKYGDLEGK
YNTAIRNYESQINDLNSQLRQYQSDLDTWRNRYGQLENENSNLKNNSSGQDNFIKEQESI
IRRLESDLQRAEDIIAQKDQELNRLANDLSNAESKIRELEFLIQQLRDQIEDQRKEIERL
QQLIQDRDHSLDMAEKDLEEADRKIHQLENENATLNEELKDYRQNYDQVLKDNELLEKKI
GDLESKTVFLAQEIDRLKLILEKRNKEIEDLKAQILKLKAEISTLETQVKDFQQKLDEKL
KDYDDLNKKLIERVLEVQQLNSQIIILNQQLVQLQSVNEKCRNQEDQIKDYLRQLDELTR
QLNKAQQEINMLQGFKDRLPEADRKAQELSKEVDRLQQLYKDKVTENDVLSQKLSTSEVE
LNRIRLIEKQFNDFKKQTQTTEQEFTRIKQTFEQKGNESDKLKQTIAGLEQQLQDKKVLA
DKLKVLEQQLAQAQKDLANLTKDRDKKDQELQRLKDQIAVLQSTLKTKEDQFNQLKQQFD
QNVNELTKVKQTQGQLEAKVSQIGLMNDKWTSSEKQNKQLQTDCDKLKKDLDQRTKEREQ
LKLDKVQLENDLLAFKSQVRK
Download sequence
Identical sequences A0BJN6
XP_001426151.1.48737 GSPATP00029381001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]