SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000013055 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000013055
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Plus3-like 8.63e-38
Family Plus3 0.00000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000013055   Gene: ENSCING00000006333   Transcript: ENSCINT00000013055
Sequence length 336
Comment pep:known chromosome:KH:2:4891749:4897420:-1 gene:ENSCING00000006333 transcript:ENSCINT00000013055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKWVHLPFFRETCIGCFVRIGIGNHNGRPVYRIAEILDVVETAKVYQLGKTRTNKGLRL
RHGQQERVFRLEFVSNSEFTDSEFFKWKEAVMLAGLELPTLDEIHKKQSAMQKAIQYNIK
DKDIDHIIKEKTKFRKNPFNYAMKKTTLLKQKEMAEVQGDGDETKRINSQLDELEERATH
LDKQRQENIAGITYINERIKSHNLLKEEACKEEWKVLRKTVADPFTRRRCKPVLVSNAED
GEQTQRLLQEMDKRYGGNVSYDIPKGNKVNKTTKETSDKESSDLFDAHDFDIKLDLQMPS
AERSLVAPKANTPTTSSDAPRRSLNLADYKKRRGLI
Download sequence
Identical sequences F6PX81
ENSCINP00000013055 ENSCINP00000013055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]