SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000016857 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCINP00000016857
Domain Number - Region: 104-181
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00942
Family Outer membrane efflux proteins (OEP) 0.032
Further Details:      
 
Domain Number - Region: 57-104
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0314
Family Cna protein B-type domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000016857   Gene: ENSCING00000008258   Transcript: ENSCINT00000016857
Sequence length 214
Comment pep:known chromosome:KH:10:1708744:1709529:-1 gene:ENSCING00000008258 transcript:ENSCINT00000016857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAVLIFLLFVHCSYAIYFHVGEKEKKCFIEELPEDTMVTGKYKAQLWDKRSNQYLDSTPG
MGMHVEIKDPESKVLLSKSYGSEGAFTFTSHTPGEHQICIHSNSTKWSLFAGGRIRVHLD
IQVGENTNDYSQIAAKDKLTELQLRVRQLLDQVQQIQKEQNYQRYREERFRQTSENTNAR
VLWWSLAQSAVLVIAGIWQMRHLKGFFEAKKFCS
Download sequence
Identical sequences F6QZ03
ENSCINP00000016857 ENSCINP00000016857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]