SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000033900 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCINP00000033900
Domain Number - Region: 41-87
Classification Level Classification E-value
Superfamily Plus3-like 0.0034
Family Plus3 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000033900   Gene: ENSCING00000021087   Transcript: ENSCINT00000030630
Sequence length 182
Comment pep:novel scaffold:KH:HT000116.1:93302:95075:1 gene:ENSCING00000021087 transcript:ENSCINT00000030630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDGIMYSMSSGMQTISLGQGQGPIAQRMIEWARTNGTWIVLQNCHLAVSWLPELRRICE
EVITDHNTTRDEFRLWLTSYPSPDFPVSVLQNSVKMTNEPPKGLRANLFRSYKSDPISDP
AFFSGCDTNEKNKEWKRILFSLCFFHALVQERRKFGPLGWNIPYGFNESDLRISIRQTLM
FM
Download sequence
Identical sequences H2XW66
ENSCINP00000033900 ENSCINP00000033900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]