SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000034654 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000034654
Domain Number 1 Region: 12-70
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0000000000000283
Family D-ribulose-5-phosphate 3-epimerase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000034654   Gene: ENSCING00000019962   Transcript: ENSCINT00000033262
Sequence length 80
Comment pep:novel chromosome:KH:13:87825:88876:1 gene:ENSCING00000019962 transcript:ENSCINT00000033262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSINKTCSTVQVRELRKAYPHLDIGVDGGVGPSSIHHCAEAGANMIVSGSAIMRSNNPCK
VISDLRGVVQEVIQQTSLER
Download sequence
Identical sequences H2XYC0
ENSCINP00000034654 ENSCINP00000034654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]