SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000007230 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000007230
Domain Number 1 Region: 156-476
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.4e-81
Family IF2B-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000007230   Gene: ENSCING00000014451   Transcript: ENSCINT00000007230
Sequence length 482
Comment pep:novel chromosome:KH:14:2925521:2930456:-1 gene:ENSCING00000014451 transcript:ENSCINT00000007230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNGDAENLTSEQKKQLKKERRKEKNAQKEKHNIPSKPEGEEPKIEKSKAELRAERRAKQ
EADRAAKASKKSDQVAANTKQKGPRVPANIQSVINLNKTILKADDPKVQKKAAKKLEKQQ
VPQRTEGQKKVALFSHLHQYERSLSITKNIGFGKNAIHPAIIRLGLQYAEGTVTGSNARC
AALMSAICKLISDYETPPQKELSRHLESKLKPAISFLDQCRPLSVSMGSAIKYIKLQITN
IPTGMSDSEAKLRLIKSLREFVHVNIVLAGEAISGYACTKITDGDVVMVFGSSSLITKVL
CDAHNAGIKFSVIVVDGRPKLSGRGTLRKLCRVGIKCSYVLVSAASYIMPEVTKVFLGAH
GLLSNGYVMGSVGTSMVAMAAKIRGVPVIVCCEAYKFCERVQTDSFVNNEIGDPRDLLVQ
NKSELTSPLLTNAAWEETDSLKVLHLTYDVTPPDFVAMVVTELGKIPCTSVPVVLRVRSL
ET
Download sequence
Identical sequences F7BH80
ENSCINP00000007226 ENSCINP00000007230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]