SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000010031 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000010031
Domain Number 1 Region: 147-371
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.7e-38
Family Regulator of chromosome condensation RCC1 0.019
Further Details:      
 
Domain Number 2 Region: 728-834
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000194
Family BTB/POZ domain 0.03
Further Details:      
 
Domain Number 3 Region: 40-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000713
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 550-637
Classification Level Classification E-value
Superfamily POZ domain 0.0000000241
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000010031   Gene: ENSCING00000004855   Transcript: ENSCINT00000010031
Sequence length 975
Comment pep:novel chromosome:KH:2:2149742:2156530:1 gene:ENSCING00000004855 transcript:ENSCINT00000010031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVCTVKCNFGKCVDDLNHVITKATLHQVKEYIRLHCFNAVARYDSSGRTPLHVAASSG
KSDIVRWICKLLSSNKCSGNVTIDSVDVESNWSALHRALYYGRIAPAMELLKNGANMWLK
DKAGCNSLDMIIADISPWNNKNSDVSELYTWGVNENMTLAQAVQKSKKMPEMVKFFSKRN
IYIKQVVMCKFHSIFVTRDGVAYSCGNGRGGRLGNGAEDVFIDPQLVDAGGSVITSASAA
VDHSVFVTADGQLLTCGLNDHRTLGINPPPQKSLLPQRVSGLRDHIIVGCCAGSCHTVVW
TSQSALYTFGTNAGQLAGWLGHGKGQPFIVQPRQVSSVHREGDKITYVHACDAATVVSTA
HGVVFLLHNYICRKIVTKQMDIIKLQVGGGILDRTVISQKKEENLDSEKKDVKVLLLKKS
GDLLSWNSGHSSLDRCQFDQKQLRWISDVSLSCNGVAALLVSADGTAYMAKFQAWIADNK
QEYLTSLDLMSSDAIQKFQLEQVPCAFRCHTAVLGPKGRNYSLLQSKPSNFLTQIPVVDA
ADITEEMRMLLESSDASDLLHDIVIHVRRDGKPDVLFPTHKFILASRSLLLSKLILSRIP
YSDEASLDLEKDKLILEGIHPKIFMNFLSIIYTGSCEMLQPGSKIDDKYPDSGRVKIFWS
DNATSAMEILTKSNQVKVECFTLLKILSNLFGIRDLSNEVFSLHGIRDGVIFSRKSGKKP
HFAPSSLPQLTDCEIESDDGICFQAHKSILASRIPFFHGMLSSPWIETSLYESRLCAQLK
VPVPGDVFKYILDFAYMDSSSSIRGATSVDSLCEILAASDLLLMGRLKQIAEVQIAPLLT
LKNVCMVAEVASAFNSNQLYESCLQFACHHLPALLHTPAFHYADEEFLDRMEVYYRSQIP
DVYRRSSPPSMEGPDVSHIPEEDLSDDITEVDFSVDRHSSDLPTSSLRKRRTSEAHSSRK
GKNKKAPGIMLSDLL
Download sequence
Identical sequences F6TCF1
ENSCINP00000010031 ENSCINP00000010031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]