SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCINP00000016651 from Ciona intestinalis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCINP00000016651
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-29
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily L27 domain 1.35e-19
Family L27 domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCINP00000016651   Gene: ENSCING00000011254   Transcript: ENSCINT00000016651
Sequence length 200
Comment pep:known scaffold:KH:HT001103.1:20328:23352:-1 gene:ENSCING00000011254 transcript:ENSCINT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTAEPLTLERDINRACELIDILKSSGQVPTQKLEQLQAVLRSDFLQAVREVYEHVYET
VEISGSPEIAANATAKATVAAFAASEGHSHPRVIEMPKTEEGLGFNVMGGKEQSSPIYIS
RIIPGGVADRHGALKRGDQLLSVNGVSVEGECHEKAVDLLKAAQGSVKLVVRYTPRVLEE
MENRFERMRLSRRQNQNSTG
Download sequence
Identical sequences F6VFD2
ENSCINP00000016651 ENSCINP00000016651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]