SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CLUT_04444 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_04444
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.91e-32
Family Ribosomal protein S13 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CLUT_04444
Sequence length 117
Comment | CLUG_04444 | Candida lusitaniae 40S ribosomal protein S18 (118 aa)
Sequence
MYALTKIRGVGRRYSNLVCKKADVDLNKRAGELTQEELERVVTIMQNPTQYKIPAWFLNR
QKDHVDGKDYHVLANNLESKLRDDLERLKKIRAHRGIRHFWGLKVRGQHTKTTSRGR
Download sequence
Identical sequences C4Y8B6
CLUT_04444 XP_002615562.1.3285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]