SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CLUT_00314 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_00314
Domain Number 1 Region: 39-97,184-255
Classification Level Classification E-value
Superfamily E set domains 0.0000434
Family Arrestin/Vps26-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CLUT_00314
Sequence length 698
Comment | CLUG_00314 | Candida lusitaniae hypothetical protein (699 aa)
Sequence
MVKAKSSHKQAALFDIRLKNVDHDVIVLKGSEHHAADTYLAGKIVLSVTEPLTVKKITLR
LVSTIRLKYSDTNVPKNAMPKVIRFEKKLYEYQWDSNEITKYLNHMYENVHNGTTSNIHN
SSSNNGSSQSMNKSNSVKSHGSTTSLKNLGLSLRSKSSTSLHLHALTSSSTNLTHSASQS
NMSLKNSHTLVSGNYEFPFSAILPGNMPESVEGLPGASVTYKLESTLERGKFHTPMVTTR
HVRVVRTMTTDAVELSETVAVDNTWPKKVEYSLSVPTKAIAIGSGTPISLMLVPLLKGLR
LGEIRVSLVELYSFIGYIPPSHSAERVVTEKTIPQPAVDEEYPLDRWEVTTFLRVPPSLS
KCTQDCDISTHIKVRHKLKFVIGLINPDGHVSELRASLPVQLFISPFVSVRARAEDQLSD
VESVGSGPEDEEEEVLFAQDPSVSELDVPDGLRSNQSASSFTGLIAPPVYEKHIYDQLWS
DVSPMESPIASGSATPRSLRTDVSQFSMASIDTAKLTENLRQLSIQRQMQENEVSQASSA
SNLRGRATFNLDGGDDTDYFSKRPNLSTRSSAFNVAAGTPGIVSPPVHLSRVGSESSMAM
SRVPSYNEAMKSSVDGSLAPIYSPPPPGSHVNIDEANRRFEEISRPTTPVGSVGRNRSFL
SRGSSSFNLKGSAGSSPSTSRNPSTNNLSSYFSEARKR
Download sequence
Identical sequences C4XWJ1
CLUT_00314 XP_002619155.1.3285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]