SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CLUT_02639 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_02639
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.15e-34
Family Ribosomal protein S13 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CLUT_02639
Sequence length 121
Comment | CLUG_02639 | Candida lusitaniae conserved hypothetical protein (122 aa)
Sequence
MGVHIFGKSIKHNALVRIGLAKRIFGVGYTTAQQICAKVGIYPRMRMNQLTEPQIMAINK
ELSDLTIEGHLKQRILENIQQKKEIGSYAGNRHAAGLPVRGQRTRNNASTAKRLNRLDRK
L
Download sequence
Identical sequences A0A202G7T7 C4Y4R7
CLUT_02639 XP_002617195.1.3285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]