SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CLUT_04035 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_04035
Domain Number 1 Region: 40-123,193-240
Classification Level Classification E-value
Superfamily E set domains 0.00000429
Family Arrestin/Vps26-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CLUT_04035
Sequence length 609
Comment | CLUG_04035 | Candida lusitaniae hypothetical protein (610 aa)
Sequence
MVYFHQTAKDLAFFDIRLKTHGHKNNIVVRGNDAEVASIPVEGHVKISTQEDLHVKRIRL
QLVGELHLDYYERSGSGNMAGLVCERDCAVKVVWPNLLTSAEGNIVYGDYGDSVVKLSKV
DAYSRKPSRDNSSSDLLSIGSNHSSGDSGTKKRPGFSRASSQPILFKNHEESLFQIPRSG
IDGTPYPLSKGSESHSFLLPQGNYSMPFHINLPSNVPESVEGLSTGKVLYKLVCTMERGR
FDRAFYRARHFRILRTLHPQSMSLTDSIEFLNTWPGKLDFNVSTPRKALAMGTTVPIKLV
IVPLVKGLSFKSMSVTIVQHDHAKGLTGPSPEFEKLIGRQKLACEESEFTEDHWIVKGKY
KVPSSLTELTPSCALKNDMISVKHRLSVGIHIKNADGHVSELKANLPVHIYMSPFHGYVT
SRRLNVDAIHGNFIANTDSTKEDVIFDRRDTDLPEEGHPDDALDDENEIDEEQESAPPLY
QQHVFDTVFDYTSAKSPMEQLRSSGNQSANGYFDIPRASSRSGTATPIDLNVLSKVPSYE
QAVDDASDDDDDDEPAPLYPSGSQLDNLSAYVTSRLGERSASMSQLLSPDRFRHKSGSRL
RFERKESPS
Download sequence
Identical sequences C4Y7A1
XP_002616794.1.3285 CLUT_04035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]