SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CLUT_05271 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_05271
Domain Number 1 Region: 108-290,317-419,453-504
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.76e-75
Family IF2B-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CLUT_05271
Sequence length 507
Comment | CLUG_05271 | Candida lusitaniae hypothetical protein (508 aa)
Sequence
MGEEKTAKPADPPAEGAEGKKLSNKELKELKKKEKAAKRAAQKEAAGITPEQQEQLAQQK
IEKRKSQATNTNLKKQLSQAVVKNEDKKIPALFSHLETREQRNASSPTVSHIVHPAILTL
SLHFSSHKIVGSTARLREMLKVFKAVISDYQTPENTTLTRHMTGHLSHQIEYLKSSRPLS
TSMGNAIRWLKQEISHISIDTPEPEAKATLCSRIDDFIRDKIDLSDQLIIENASQHINNG
CTVLTFGHSEVLSKLLQHAVLEQNKSFNLVIVDSRPLFEGKKLLSELVNAKIQPSAEELE
SNPNLKYEPPVAITKERLSVQYVMINSLSSTILEDVDYAFLGAHAMLSNGYLYARVGSAM
VAMMCHKRNIPVITCCESIKFSDRVQLDSVTTNELADPEDLVKNSQLPPVKKSLALEQFI
KSQEESEKKQSEKKQSGSRKQNQNDKKDSEQEASAEPLSNWKDIPYLNILNIMYDLTPPQ
YINKVVTELGSLPPSSVPVILREYKST
Download sequence
Identical sequences C4YAP3
XP_002614493.1.3285 CLUT_05271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]