SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CLUT_05313 from Candida lusitaniae ATCC 42720

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CLUT_05313
Domain Number 1 Region: 220-280
Classification Level Classification E-value
Superfamily E set domains 0.0000868
Family Arrestin/Vps26-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CLUT_05313
Sequence length 983
Comment | CLUG_05313 | Candida lusitaniae hypothetical protein (984 aa)
Sequence
MEEPRSPLFPASSLAPGIEDSNQYFIPQLPDNPTVQTSSLQVYVVTTEKHLFVQGFNASE
QEGRPPTLLRGCLVIRVVKPSKIRSISLVFKGSVRTDWPEGIPPKRNVYADGHDLVTHTW
PFYQMETPVPKCGADIYVPCGKSGVHEDVSSLNLAESNTPQLMPIESATSFAANLVKRAT
SPLSGSSSNHLAPTASGLTSVLSASSYSGADDESKPGHFSPGYYVYNFEHPLPASTPETI
SLNFGHVAYSLEASITRVGAFKSNLTAKVPVDVVRIPSDNSVEENEPIIIEREWEDQLRY
EIVVGSKSVVLDSYLPLSFRFIPLFGKVALHRIRVYMTENCNYYCNNKTVHRAEPVRKFL
LLEHKAKKNKSLISKSGGLTDGPAPEDDEVLPREMEFQMFVPSTINKKYNYCMHPDTAYD
DIQCDHWIKISLRISKQDPENPEKRKHFEISIDSPIHLCSPLAAHNHTLLPSYDMEPEFL
PVYTPTSPPMSPEVTALDCSHNGGLGRSLLSAISGISGQQNGSPGARSDISRPLTPLEFH
HISSPNNNDVPIERDPNIHLEANLYEPPDEEVLEKLGSPQAKPFSPQIKAFSPIASPLMS
PVLSRQPTINPPSFEQPGVSQDVLPPAYEREDPAHIIASIALDDSRHGSDMKSVHSGSHL
SGLGGEPSIKDILSRQLDQRSRNSQSDRESLRSAQTSHASDKDSMKSHQNSNNGDTSSIR
SAQNSKHSLSDENRKKNGETPDSIGTNNTVGGHTHESTKENSTSSAAMKNNAVKDVSNDT
LLPGTAMHQDDTEIADLDITDVTPFGHDISPSIMKPAKSRNSSISSFTSSAVGSDDIPFD
QTFPLLSLSSTSILDGLRQSFDDPMQKSGFMGTPSMTDLVDSNFFGNDEHRINGSLSRLR
NPRIKKHYQDPPQIVEPGVAIAGSKDRQKSFGVIPSFTFDTSHSHSPNRSSTESDVTIDE
ISQSGRKGDTFIEPLDLQEVASK
Download sequence
Identical sequences C4YB21
XP_002614535.1.3285 CLUT_05313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]