SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PADG_01536T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_01536T0
Domain Number 1 Region: 96-340
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 9.16e-70
Family Glutamine synthetase catalytic domain 0.0053
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.7e-19
Family Glutamine synthetase, N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PADG_01536T0
Sequence length 344
Comment | PADG_01536 | Paracoccidioides brasiliensis Pb18 glutamine synthetase (345 aa)
Sequence
MKYMSLDQRGHVLAEYVWIDASSGVRSKTKTLNGPVKSVEELPEWNFDGSSTGQAPGENS
DVYLRPVAMFPDPFRRGDNILVLCETWDSDGSPNKFNYRHEASKLMRTHAHEHFWFGLEQ
EYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVHCRDIVESHYKACLYAGIKISGINA
EVMPAQWEYQVGPCEGITLGDQLWMSRFLLSRVAEEFGAIISFAPKPIPGDWNGAGLHSN
VSTEAMRSEGGMKVIEAAMKKLESRHSEHIAVYGEGNEDRLTGRHETGSIDRFTYGVADR
GGSVRIPRQVAKDGKGYFEDRRPASNADPYQITGIIVETLCGAS
Download sequence
Identical sequences PADG_01536T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]