SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PADG_04686T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_04686T0
Domain Number 1 Region: 117-482
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.57e-90
Family Glutamine synthetase catalytic domain 0.000057
Further Details:      
 
Domain Number 2 Region: 19-111
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.000000562
Family Glutamine synthetase, N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PADG_04686T0
Sequence length 484
Comment | PADG_04686 | Paracoccidioides brasiliensis Pb18 glutamine synthetase (485 aa)
Sequence
METEITLESLPAVLERDTRVKLAGIDADGILRGKLVSKKKFLSVAQNGFGFCSVIFGWDM
HDQTYFKDLGISNKENGYRDMVAVPDLSSFRRIPWEDNVPFFLVSFFDPDTHAPISACPR
GLLRTAAEKIEKLGYRAMVGAEYEFHQYRAPSTSPGGFERNSSATAAFLKENPVTALQPL
TEGMFGYSLTRTVHNQEYFYAIFNMCQAFQCDIESWHTESGPGVFEAALEFGEIKEIADR
AGLFKYVVKSIGSKYGITPVFMAKPRQGIPGNSGHMHFSIVSKTGENIFSRETPDPSPPY
PDVAYLSDVGRHFLAGILDGLPDIMPIFAPTINSYKRLVENFWAPVTVSWGLEHRAASIR
VIAPPTSKPKATRLEVRVPGADANPHYVLAAILELGWRGVVKKLALPVPPLPKGEDVGGS
TDQGIRLAKTLKEAVATFMREGSVAREVFGDAFVDHFGGTREHEICLWEEAVTDWEVKRY
IETV
Download sequence
Identical sequences PADG_04686T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]