SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PADG_05225T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_05225T0
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.36e-51
Family Decarboxylase 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PADG_05225T0
Sequence length 285
Comment | PADG_05225 | Paracoccidioides brasiliensis Pb18 orotidine 5'-phosphate decarboxylase (286 aa)
Sequence
MSSQSHIPYAVRASRHSNPLARQLFQIAEEKKSNVVVSADVTTSKELLDLADRLGPYITV
LKTHIDILTDLSPTTLTSLKSLASKHRFLLFEDRKFVDIGSTVQKQYHGGSLRISEWAHI
VNCAMLAGPGIVDALAQTASTPEFRSVYANEVEGGRALLILAEMTSKGSMATGAYTQLSV
EAARRHRAFVLGFVATRALNDVLPVSTVDGDEEDFVVFTTGVSLSASGDALGQQYQTPAS
AVERGADFIISGRGIYAAEDPLEAVLRYREEGWKAYLERVKGWKA
Download sequence
Identical sequences A0A1D2JB52 C1GD89
XP_010760927.1.95046 PADG_05225T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]