SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PADG_08604T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_08604T0
Domain Number 1 Region: 10-226
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.38e-55
Family Phosphate binding protein-like 0.0000562
Further Details:      
 
Domain Number 2 Region: 228-299
Classification Level Classification E-value
Superfamily GlnB-like 2.11e-20
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PADG_08604T0
Sequence length 302
Comment | PADG_08604 | Paracoccidioides brasiliensis Pb18 ATP phosphoribosyltransferase (303 aa)
Sequence
MDIVNHLEGRLLFAIPKKGRLQQSAIDLLAGSDIQFRRETRLDIALVKNLPIAIIFLPAA
DIPTFVGEGRVDLGITGRDQVAEHDANLLPDEVSGVEEMLDLGFGGCKLQVQVPQKGLIM
DPKELVGKHVVTSFTGLTQGYFAKLEGKQSSSTKIKYVGGSVEAACALGVADGIVDLVES
GETMKAAGLKAIGTVVESTAVLVKSRKTTHGLVELIESRIRGVIAAKKYVLCQYNVPRPL
LAAACEITPGKRAPTVTPIEDAGWVAVSSMVEKKSIATVMDQLTIVGATDILVISISNSR
TR
Download sequence
Identical sequences PADG_08604T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]