SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PADG_01795T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_01795T0
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.83e-25
Family N-terminal domain of MutM-like DNA repair proteins 0.003
Further Details:      
 
Domain Number 2 Region: 159-248
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.15e-23
Family Middle domain of MutM-like DNA repair proteins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PADG_01795T0
Sequence length 385
Comment | PADG_01795 | Paracoccidioides brasiliensis Pb18 conserved hypothetical protein (386 aa)
Sequence
MPELAEVARVVHYIRKYLVGKTITKVHVQDDPIVFGKVGTTAAEFQKHMEGKSIVDTGQQ
GKYFWMIMSSPPHPVMHFGMTGWLKLKNVHTYYYRAPASDKGNDREDEPWPSNFWKFMLE
LDDEPKTEAAFVDARRLGRVRLVDCPGTDIRKYSPLKENGPDPIVDKDIVTLDWLRKKVL
SKRVPIKALLLDQTNISGIGNWMGDEILYHAKIHPEQYSNTLQESQIEQLYSAINYVCST
SVGLLGNSEEFPSNWLFSHRWSKGKANHSHQLPNGEKIVFITVGGRTSAIVPAIQKKTGP
VAGDVEDGATDDNNEPPKKKRGAASKKDSKYVENVESHSPAKKPTMKKPKDEPKIKESKS
KKQTDTAQTEENKTPKNRRSTRSRK
Download sequence
Identical sequences A0A1D2JM22 C1G4C9
PADG_01795T0 XP_010757581.1.95046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]