SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PADG_07756T0 from Paracoccidioides brasiliensis Pb18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PADG_07756T0
Domain Number 1 Region: 3-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-86
Family Capz beta-1 subunit 0.0000000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PADG_07756T0
Sequence length 266
Comment | PADG_07756 | Paracoccidioides brasiliensis Pb18 F-actin-capping protein subunit beta (267 aa)
Sequence
MADTQFDSALDLLRRLSPRDTRQNLQYITTLVPDLTEDLLASVDQPLEIRRCAQTKRDYL
LCDYNRDGDSYRSPWSNEFDPPIEDGTVPSERVRKLEIAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVVLLKKVITPGSKNSGAWDSIHVFEATDRARTCHYKLTSTVILHLSTGSE
ALGEMDLSGNITRQIEADMAVDGDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDIVSD
LRSIQPLSETNRDQANHREVINSMKW
Download sequence
Identical sequences A0A1E2YFN6 C1GKH0
XP_010763140.1.95046 PADG_07756T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]