SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CAWT_01484 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_01484
Domain Number 1 Region: 645-760
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 
Weak hits

Sequence:  CAWT_01484
Domain Number - Region: 861-977
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000202
Family cAMP-binding domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_01484
Sequence length 998
Comment | CAWG_01484 | Candida albicans WO1 conserved hypothetical protein (999 aa)
Sequence
MASPYGIPNKSTGNDNSETFDFGGRSYVSMSYKPSLLSSSLVNTGVEVHEQTANLASVLV
TESLNEDENEDDLEQQQQQQHHREEESQDHQHSLSESSLLMPNSPRNNYFSQADALESEI
GSPSVNSFGRRSHSGSNPSVNSLPQPSPSSLSLSPKDNIPEKQPSKLHSYLVKPIRYIPG
VFLGTLLNILDGLSYGMIMFPISESIFASLAPAGLSMFYMSCIISQLIYSLGGSAFKAGI
GSEMIEVTPFFHTMAGAIAKQMTNESNGNNNINNDAIIATTITSYAVSSIVTGLVFFLLG
KLKLGVLVGFFPRHILVGCIGGVGYFLIATGIEVSSRLEGGLSYNYETFKYLFYNHTTLL
EWTIPLLLALILIILQHKYHNSLLVPLYFIAVFIIFHLSVAVVPSWNLNNARINGWIFPM
VEDNEPWYSFYSLYKFNLVDWVCIVRQIPTMLALTFFGILHVPINVPALAVSVGMDQVDV
DRELVAHGYSNAISGLVGSIQNYLVYTNSVLFIRAGADDRVAGVMLAIATAAVMMVGPVV
IGYIPVCVVGALIYLLGYELLKEAIYDTWGRLRNIEYITIIIIVVTMGAVDFVAGIGVGI
LLACLSFVVEAGRTPVVQGIYSGSVARSTVMRHPKQQEFLKNVGEQICIVKLQGTLFFGS
IGGVEKEIRNMFEHDKFKSNPIKYLIIDMKGVISLDFSAAEGFRRILNLANDFKTQFIIS
SVGEDDDIIQGLRDAGIFDNGANAPIELFSSLNYALEWCENSFLKTYSKLKKSDPVKTRS
VPGSSTLTTTRQSFASPSSYGAKIFGKYGEFGTPRTNQVFQAASKTVYDEHKTESKFESQ
KNSLFQKQPLSLIMLSFQGLSDKDAEFWSNITPYFVKEKIPENYQFYDTKNDEPAFFIVE
SGLIRSIIKFESEGRELHSSILPLVAFGDLDDASEYRQIIYTTVNDTVVWKLTQAKLKEM
LAKLGSKGEELYHELLEVEAKLIRGRFDTMTANLIIAG
Download sequence
Identical sequences C4YNM1
CAWT_01484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]