SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CAWT_04926 from Candida albicans WO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAWT_04926
Domain Number 1 Region: 577-688
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000173
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAWT_04926
Sequence length 757
Comment | CAWG_04926 | Candida albicans WO1 conserved hypothetical protein (758 aa)
Sequence
MKRTPRSDTVSPDRSRLTSPSPSIRHISHTRVNTERSYLLHKDSTPQVADAESIIYQDEY
TPANTHNVESLSWSEILPYYIPCLSWIGQYSVEFFVGDLIGGLSLVFFQLPLSLSYATSL
AHVPVTSGLYSLGISPLIYLIFGSVPQMIVGPEAPISLIVGQAIEPLLHHAKKAHLDPVE
YVVAITFVSGSTLLGFGLARFGFLDNVLSASLLKGFIAGVGIVMIITSSIIVLGLEKLMK
QISDDPNEMDIHSPFDKVRFLIQYIGQRNQQSLNIGLVGFFIIFTIRLFKKHAAKQNGRL
YKYAVFIPEIMLVVAGSTILCQHYRWDLGGLPVIGKVRNEGDFKFYNPLSLSNLHLIKKL
CASGFMCAMLGFFESTTASKSLGSMYDLPISSNRELVALGSINIFGSVFGALPAFGGYGR
SKVNAISAKTTMSGGIMGICTLLTIHFLLKYLYFVPQCMLSVVAAVIGISLIEEAPYELY
FHWKTKGIDEIITFCVTVVTTLFFSMEGGIAVGIGYSLVRVFKNSTFSRIQILGRYPNTN
KFVNADIPAYQTSQEKVAGSYLNLFDDAQHMQLNTQVLEEVEGCLIIKVPEPLTFTNCSD
LTTRLKRVEMYGSTRAHPASKRSRDIGMTKYVIFDLKGMSSLDSTAAKILKTLLEGYRKR
GIRTCFVRMSSDKHLRKMLADSGICKLLIDDLTDLKYFAIQEIAEQNSQPVTTPEMEAMV
ECYSLIESSSHPYFNHISDALKVIDCFETNYVDTIDA
Download sequence
Identical sequences C4YS67
CAWT_04926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]