SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217966924|ref|YP_002352430.1| from Dictyoglomus turgidum DSM 6724

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217966924|ref|YP_002352430.1|
Domain Number 1 Region: 2-249,325-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.99e-95
Family Type II chitinase 0.00000459
Further Details:      
 
Domain Number 2 Region: 249-324
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000392
Family Chitinase insertion domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217966924|ref|YP_002352430.1|
Sequence length 372
Comment chitinase [Dictyoglomus turgidum DSM 6724]
Sequence
MSPKRIIAYFPEWKVKDEYLNYSVEDIPWKLLTHINYAFAKIVEGKLHPIEEDLFYSNME
KIKEYKKEYRDVKVLISVGGWTDSGEFSDVALNEENRKKFAKSALELVKEFNLDGVDIDW
EFPVSGGLPTNKARPEDKENFTLLLKTLRDVLKEENENYLLTIAAPASYTQIHNTEPDKY
HIFLDFINLMTYDFHGIWDKYTNHHSPLYGNPKDPDEKSRERANCDFAVKEYLKFGIPPE
KIVLGVPFYGKGWICEDDGHNGLFAKVKGIPYGIFDNEDHPSGSNPFFFIKGVIENDPNY
IKFRDKYAKVPWLWNPKEKIMYSYDDEESILEKCNYVIKNNLGGIMFWEVTQDYPFKGHT
LVKLIHQKFWEG
Download sequence
Identical sequences B8DZ83
515635.Dtur_0523 gi|217966924|ref|YP_002352430.1| YP_002352430.1.71678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]