SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217967258|ref|YP_002352764.1| from Dictyoglomus turgidum DSM 6724

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217967258|ref|YP_002352764.1|
Domain Number 1 Region: 9-210
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.91e-45
Family PP-loop ATPase 0.00026
Further Details:      
 
Domain Number 2 Region: 324-448
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.31e-19
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.022
Further Details:      
 
Domain Number 3 Region: 217-304
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000706
Family MesJ substrate recognition domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217967258|ref|YP_002352764.1|
Sequence length 455
Comment tRNA(Ile)-lysidine synthetase [Dictyoglomus turgidum DSM 6724]
Sequence
MIKDINSLDYIEKKVLNFTRSESLISLGDSIILSVSGGSDSIALSEILYNLSPILGLKLH
IVYIDHHVRKNTYKEKELIKDYATSRNIPYSFLDIYPKDFTEKTLRDERYKALIKFSEEL
NFNKIALGHTLDDQIETIIMNFFKGYGMEGLCGIPVKRDKFIRPIIILSKSEVIEYCERK
SLKYIDDFTNLLPITLRNRIRHQIVPFLKETIQQFPQSVISQSKILYIENDFLKNISLEY
FNKLKGSNTMIEIEREDWNTMHDAIKIRVLKEVFKDFNEELSNEGIFYILKEVSEIKEGK
TINIGNVEIYIYNKKIYVYKKERNEFLLILPIPGKINLPTGEVIEAKLLENKKTEFNFNN
LWQAYFDYDKIKAKELIVRNWKEGDKIKPFGLGGKSKKVQDVFVDKKIPRWKRTVVPLVL
YKDEILWIPGIIRSDIAKITNDTKTILHLSLKKEG
Download sequence
Identical sequences B8E067
YP_002352764.1.71678 515635.Dtur_0869 gi|217967258|ref|YP_002352764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]