SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217967691|ref|YP_002353197.1| from Dictyoglomus turgidum DSM 6724

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217967691|ref|YP_002353197.1|
Domain Number 1 Region: 204-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.32e-71
Family B3/B4 domain of PheRS, PheT 0.00000914
Further Details:      
 
Domain Number 2 Region: 467-692
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000635
Further Details:      
 
Domain Number 3 Region: 42-186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.8e-34
Family Myf domain 0.0042
Further Details:      
 
Domain Number 4 Region: 699-789
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-24
Family Anticodon-binding domain of PheRS 0.00059
Further Details:      
 
Domain Number 5 Region: 404-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.38e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217967691|ref|YP_002353197.1|
Sequence length 799
Comment phenylalanyl-tRNA synthetase subunit beta [Dictyoglomus turgidum DSM 6724]
Sequence
MLISYRWLMDYFKEEIPVKEVINALRNLGLYATIQKRIGENWEKIIVGEIKSIERHPKSE
NLLVCEVDTGEKNLKVITGAKNVFVGAKVPVALPGIEILGEVIGVREFEGVKSEGMLCSE
YELEFSEDKEGIMILPEDFKVGTTFDSHFGKGDFLVEVEVPSNRGDCLSYLGIARELSGY
FNIPLNFEFKKVQEKNDIKIEDFAACEVLDFDLCPRFTLRFIKDVKIAPSPLWLKWRIER
VGLRSINNVVDITNFVMLETGQPLHAYDFDLLKGGKLIVRRAENGEKIVLINGEERILDR
DVLVIADAERAVAIGGIMGGKDTEINDNTKDVLLEAAYFLPVNIRRSARKLGLRTDASLR
FERGVDIHRTSDILDYAAEMIRLIAGGNIAKDKIDINRGLPSLTKVFLRPERVNKVLGTT
LKEDEIINILSKIGFNIKSQNPLFEVEIPSYRQDIKEEIDLIEEVARFYGYNNIPSIPLQ
KGHIVDPPLMEEIIERKIREILPNFGLYETINYSFMSIKDLEKVGILSTEPFNSFLQISN
PLSEENSILRTSLLPSLLNVAQININRQQRDVFIYEIGKVFYKKDNSYFEEKHLGILMTG
ESYKDPWNIPYEIRKADFYDLKGIIEAIFEKIWGREPIFKKSEYSFMHPSKQGYIVFKDE
IVGFMGEVNPWITQNLDIRERVYFAEINLDKLNFEKPRPQYKSLPIYPGIRRDLALLIPE
EMPVESVEKEILKISGDLLKMIRIFDLYQGEKVEKGYKSVTFSLFFLADDHTLEDKEVDE
IINKILIDLSIKGVYLRQK
Download sequence
Identical sequences B8E0D8
YP_002353197.1.71678 gi|217967691|ref|YP_002353197.1| 515635.Dtur_1309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]