SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217967156|ref|YP_002352662.1| from Dictyoglomus turgidum DSM 6724

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217967156|ref|YP_002352662.1|
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.95e-22
Family Crotonase-like 0.048
Further Details:      
 
Domain Number 2 Region: 360-420
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000288
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217967156|ref|YP_002352662.1|
Sequence length 423
Comment hypothetical protein Dtur_0766 [Dictyoglomus turgidum DSM 6724]
Sequence
MKKILYTILFSFLLLSFLNAQPQNVYVIPIKGTIELGLASFVERSLKENPNAKAFIFEID
TFGGRVDAAIRIRDAILSTPNLTIAFIKDRAWSAGALIALSCEKIIISPSGSIGAAEPRP
AEEKTISALKAEFESTAKKRQRNPKIAAAMVDADEVIPGLKQKGKILTLYAEEAKKWKIA
DEILEDLDSVLKYFRLEKAKVTNLHPNWAENFVRFITDPTVSSIILTIGMLSLYVAIFTP
GLGLPELLALICLGLFFGGHYLAGLAGLEPLILFILGLILIFIEMHTPGFGIPGIAGSIS
VFLSIYWTIVQKGGTFQALLTGIFVVLSLIIFLAIYLPRSRVWKKFGLSGSQKKELGYTA
VQERKDLIGKKGKTITMLRPTGIIEIDGERFEAYSESEFIEPGEEVLVFKVEGNKIFVRR
SEK
Download sequence
Identical sequences A0A2K2VBU0 B8DZW5
515635.Dtur_0766 gi|217967156|ref|YP_002352662.1| YP_002352662.1.71678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]