SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITG_01815 from Phytophthora infestans T30-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITG_01815
Domain Number 1 Region: 2047-2342
Classification Level Classification E-value
Superfamily BEACH domain 2.88e-89
Family BEACH domain 0.000000541
Further Details:      
 
Domain Number 2 Region: 2375-2635
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000224
Family WD40-repeat 0.0087
Further Details:      
 
Domain Number 3 Region: 133-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000699
Family Clostridium neurotoxins, the second last domain 0.052
Further Details:      
 
Domain Number 4 Region: 1924-2033
Classification Level Classification E-value
Superfamily PH domain-like 0.00000135
Family PreBEACH PH-like domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITG_01815
Sequence length 2754
Comment | PITT_01815 | Phytophthora infestans conserved hypothetical protein (translation) (2754 aa)
Sequence
MTITLHWQWAGRNTARRRLRACRSDALRVLRRSSLTLSASCGNVEACSTAGLQRAILSFL
SERGLFADPNLPLAVLKKLLRVFLYLAYHSVNIDDIQAMLAVFRSMRMVHEEPDDQAVSY
YLSTLEMIARDSFGPASFFDLNGEFSGLLMPVLPAFPNTGYTFCAWIKFEFLPEEVAPLF
TFCGKTGVGITCSFLRSSLMITSFDKRKNDGHVEVPDLVTPGRWHFLCITHTHRQFRGSK
LDVYLNSELRQSVRLAYPNTALMAPVVKAYLAMRESNGTNALRILLGPTALFGQALPASI
INNIRSVDEYDALVFQFNSYISSSSTSSGSGVSGAPGAPGGSNASGNSTDGLLLAYDARH
CDRLKGLCYDSSGNDYHAAAASAGVRLRHAGTFKQAVAQLGGPLVCLPLLVTSTTAAVST
VSATATNSNGNADDASENTLVARISLAGTSVALTTQFDEDSDFLKQMSDLIARPMGVRSI
PKVMLLIAEIMRHSLVNKFIFRRSQGVRLMALLMRSLPPQYLTSELLIAIERLRSAVISD
RILADEIYKFLLFNFRIWVNAPVDLQESMFDKLEIMTRKDSKNLSPASTRHFLRCLSWIY
WKTPSSTTLRRARDFSQEEIDVLRKRVLAMIQIVLCESPPPKAAGSVMTFPGKGKEVKSQ
LSYESTRSLIFCMIGKPSNPMVPGMNIDGTPAIQEVGPSNGAPSSATVSSSSSTKSIPES
DLDGSGSVVENVPETDLPDLLQLLIELSIQPTAPAGMLDLFGRLGGLRIWLPLLEFSNDV
IRVMTLRLLRTYLYLKCECTQDREMVNNPDKIQLSVGDAYLIMHSLKPEKRPVSMGVYSE
ILLMILGIQVTEKNMKALDGKTAAFDALIDENVLATATIWHDNMMPAFLGLVRASSVTIR
MVAIRHLKIIFASSTIASAINRHILIFGSISSMGGTATESSTTEQVPIIESILSLRGDPQ
RLDDSPPSPPPSLFGIELHGCPGVPMSRLRDMVLNTQEPDEVRVNALFSIITQDDVDFVR
GLLALHGDGDRKKQGVSASCFNDMSSRMKLALVELMSVYQPSGCVDFITMMSYDVISSMI
CLEVKSNEMAWFLLQDPFTTLSRFIASAEELEVVVVSLLKTTLDKMNEMLSAEMNLRINE
GTPSRESILWRNAESLASLAAAVVLHYDPDTLGGVDPSTLVGTDDVTQSLVFWKCERAIW
HEAELVDSILGIWQHFASHFHSNSDASFARRSSNAHRRNSTPTRQMDSGLQSPPSLGSAA
RSSAGTSMLGFGFNLLPTGVVSSASAANPPTTPLSGGSNISARPHPGGPMRQILQLLLRC
LYLVLISDDHEAAASGDGSDNDELSSVKLRLPANSVFFQRINKLEYFINAMGLGHEIAQF
DSCFAPSRSGSNGLTTTAGLVTASECIKASPGDETTLLLWLIPELSALIDRVRRKCWSES
AVKLASILASLVSVPLRSSDQLVELLGRNDFTTNNQEVRRRDCFYHEQMAHARDIRAMRR
VGMFDEEADEKNRAKLELERISKFTRSLTSLGPPSSNGEDHVWLERVKAKDIDDWMKLRV
LAKWGVRHVWGVKEEAVVDAVGDGTIIGLWGDNEFWRVDIYTSSNWIRCRLLPDTDDTIS
HNFKLSSLKNEMLNNMADELTMPPVDSIVVDDASGDSTEQTLEEEDDDEAHTVSSGGDGD
GSDGGESEEPAYVGLARRLSDVGYMDDDSSPSQLEASGSRDDVPPRSMLRDRMHSSDSVG
EVVDASSRLDIIGQNPDLISTAPLALAPPTPEVSDNVTPVNEDDSPIRDRRAVSIDVATT
VKSAKGRIGTISTRFSSGIKRLAGARPTTLSGSTSAEMTGSHRSLSNVSEEDGDANPQDS
PDTAGEEMSRKEPTKPSSPTEPRSSGPSSRMMKKFPSKHEHWKTLGSPYRTKAYLVLPSG
VLVHGVLRIGAATIVFEGERVVTLRGIADAFKTNEDGGTAARQRGAQRLHAAYVSQLKRR
VWGVRVIRVIHRRRFLMEGQNGLEIYFVDGSSCFFGLESNGEADLVYATLRERKPPCLAK
WGKRLLSADRMLSKSKWTDMWVRREISNFEYLMALNVSAGRSYNDPSQYPVFPWVIKDYE
SAELRLDDEDIYRDLRRPIGAQTAEAIQRARATYEGWDPKTPIPAFHYANTYSHVQSVLY
FLIRLAPFTGAVLGSEEQQFHLKAAGEPTFDSVPEAFQMCTSDERHMFELTPEFFYLPEL
FSSARNKTLARHFTPGQDVSATAGLARDVALPPWAASPYDFVRLHRLALESDYVSSNLHH
WIDLIFGNKQTGSAAVDALNSYHIACYPERLDLGTSSDGVRAKLVQRGTVPIQLFRKPHP
ARMTQDEALEARYPASHSMAVLSSRRQVRRHDLPSKHTAAVKSVRFSNALNQAVALTALT
GSGPGLGSGTGMGAHSTGSNDHGVVVYTTDSDGVVLAKRYLNSVPDTVRSCPFSMVDVDQ
WWKLPAGCLVSEGVVFYEQMISCGYWDGSWRIHWAADGELLQRIAFHKKPILCMARSEDD
FTGDLALAFGSEDCTVSVWALSKLSASRSRRLFLKKELPVGGLPWVLLVGHTSPVVAVAL
NVDLDVVVSASKHNMLLLHSLRGSTPLHALALTPGPMETSAVAHMVISAQGDTLVHSITT
HKTQRSGRFSRANSLFSDDKARLTVGESSSNNSSMVAGGLSSSGYVATNDQHEKRNDGAE
QQSELYMVSINGHVVSHDKLVVRGEEVADGDDDKAQIPHLLLERGVLFTRSGDA
Download sequence
Identical sequences D0MU57
PITG_01815 XP_002908421.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]