SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SPAC869_05c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPAC869_05c.1
Domain Number 1 Region: 584-613,650-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000116
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPAC869_05c.1
Sequence length 840
Comment | SPAC869_05c | Schizosaccharomyces pombe 972h- sulfate transporter (predicted) (841 aa)
Sequence
MRAWGWVRNKFSSEDDYNDGASNKDYPDRFNEFDNSQNDHNDYTQNNAQFQNAQTTTFGR
TISRVKAYYEIPEDDELDELASIPQWFKKNVTSNIFKNFLHYLKSLFPIIEWLPNYNPYW
LINDLIAGITVGCVVVPQGMSYAKVATLPSEYGLYSSFVGVAIYCFFATSKDVSIGPVAV
MSLITAKVIANVMAKDETYTAPQIATCLALLAGAITCGIGLLRLGFIIEFIPVPAVAGFT
TGSALNILSGQVPALMGYKNKVTAKATYMVIIQSLKHLPDTTVDAAFGLVSLFILFFTKY
MCQYLGKRYPRWQQAFFLTNTLRSAVVVIVGTAISYAICKHHRSDPPISIIKTVPRGFQH
VGVPLITKKLCRDLASELPVSVIVLLLEHISIAKSFGRVNDYRIVPDQELIAMGVTNLIG
IFFNAYPATGSFSRSAIKAKAGVKTPIAGIFTAAVVILSLYCLTDAFYYIPNAILSAVII
HAVTDLILPMKQTILFWRLQPLEACIFFISVIVSVFSSIENGIYVSVCLAAALLLLRIAK
PHGSFLGKIQAANKYGSDNIANVRDIYVPLEMKEENPNLEIQSPPPGVFIFRLQESFTYP
NASRVSTMISRRIKDLTRRGIDNIYVKDIDRPWNVPRQRKKKENSEIEDLRPLLQAIIFD
FSAVNNLDTTAVQSLIDIRKELEIYANETVEFHFTNIRSGWIKRTLVAAGFGKPKGHAVD
ASVCVEVAAPLRDANLSAESSRNLSRIITPIYDDEEGNVSGHIYELDGKNNSDLSMHCQK
GSNQVEIEFVEFNSRKYPFFHVDVASAVVDLQHRLLSPQKSDSFGSLKEGGTTTIKKIEN
Download sequence
Identical sequences Q9URY8
NP_595014.1.19918 SPAC869_05c.1 SPAC869.05c 4896.SPAC869.05c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]