SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188585317|ref|YP_001916862.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188585317|ref|YP_001916862.1|
Domain Number 1 Region: 1-292
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.53e-81
Family Methylenetetrahydrofolate reductase 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188585317|ref|YP_001916862.1|
Sequence length 305
Comment Methylenetetrahydrofolate reductase (NAD(P)H) [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MKISEIFSQSNGPVVSFEIFPPKRKKNQSKEDFDSLLKTIDNLARLKPDFISVTYGAGGT
NSDGSLEISEYVKNKGITSLPHFTSIGYPVEEINSYLGTIYNKGFENILALRGDLPKSPS
KADLVWRDFLHATDLIKVISRDFPNFCIGGAAYPEGHQESSYAGQDIEIMKIKEKMGVKF
FLTQLFFNNDNFFKFMENVRNNGVESPVSAGVMPLISPKYVDKIIELSGVKLPKELENAL
ENYRDDEVEFRKRSLDYCVRQVNDLFERGVDGVHLYTMNRHEAVEEILDQVDSNVNREVE
LSKQT
Download sequence
Identical sequences B2A780
457570.Nther_0681 WP_012447158.1.10671 gi|188585317|ref|YP_001916862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]