SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188585781|ref|YP_001917326.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188585781|ref|YP_001917326.1|
Domain Number 1 Region: 48-98,250-456
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.4e-51
Family Bacterial dinuclear zinc exopeptidases 0.011
Further Details:      
 
Domain Number 2 Region: 118-263
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000196
Family PA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188585781|ref|YP_001917326.1|
Sequence length 462
Comment peptidase M28 [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MMENIVTKDLQKVSVLHLLRDQRGVFAYSSKITITDKGVVTMEIFESDGLRMYEDIVDLA
ALGDRFAGSTAEKEAGEIVKKSFIQSGLEVYEESFDVFSFYEKNSQIKLRKPLELTFDTR
AMYYSPGTHKEGLQGELVYVKNGLEQDYEGKDVEGKIVIFHRDDKQIKDHFWPEIKTASE
KGAIGAILINFDDWEFITTLETGYFEPSKRFLPIEPNEIPSVIVSKNKGDLILDLMNQEK
VIVDIIVDTLNEKMRSSNIRGVKAGSQNNNEKILIYGHRDSAGTPGANDNGSGTVIMMEL
ARLLKDMKLNRTIEFLSTGAEEQLGAAGALEYINRHKSELNNIKAAVELDMVGNGNSLCV
MKGGEWPDKTVNFPDKVCQFFYEKAREYGYAVEYGFNDFGTPDSGKFASAGVPTTWIWGP
DDIYYHSPEDTPEKVDRNKLKIVADMLLKVILDLDKQETLNF
Download sequence
Identical sequences B2A1J8
WP_012447613.1.10671 gi|188585781|ref|YP_001917326.1| 457570.Nther_1155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]