SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188585992|ref|YP_001917537.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188585992|ref|YP_001917537.1|
Domain Number 1 Region: 95-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-51
Family Nitrogenase iron protein-like 0.000000412
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 9.16e-25
Family Domain of the SRP/SRP receptor G-proteins 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188585992|ref|YP_001917537.1|
Sequence length 310
Comment signal recognition particle-docking protein FtsY [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MGIFSKIKDGLTKTRRGFVSQIEKLLTGKKIDEEFFEELEDILISADVGVDTTLKIVENL
RQRIKEEKIKDSETVNQVLKDEMKDMLMQKDKSLTPQEGTPKVSLVVGVNGVGKTTSIGK
LAYKHKQEGKKVVLAAGDTFRAAAIDQLQIWGDRVGVDVIKHQEGADPAAVVYDAIQAGR
ARNADHLICDTAGRLHNKKNLMEELKKVSRIIEREIGTPPHDVYMVLDATTGQNALSQAK
LFSEVTPVSGIILTKLDGTAKGGIVLALANEMEIPIKYIGVGEGMEDLQDFDPDQFIDAL
FANSGENNEE
Download sequence
Identical sequences B2A2N4
WP_012447824.1.10671 gi|188585992|ref|YP_001917537.1| 457570.Nther_1366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]