SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188586014|ref|YP_001917559.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|188586014|ref|YP_001917559.1|
Domain Number - Region: 87-120
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0667
Family Phase 1 flagellin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188586014|ref|YP_001917559.1|
Sequence length 134
Comment flagellar basal-body rod protein FlgB [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MFEQAPIGLLGNSLNGTTKRHEVISNNIANVNTPGFKRGRVDFEEQLKEAMKADSKDIEG
KITREKHIPIGKVDSTIEPQVRRESDSSMRNDDNNVDVDTEMSRLTQNSLHHQALTRQLS
SEFNKLRSAIQGGR
Download sequence
Identical sequences B2A340
WP_012447845.1.10671 457570.Nther_1388 gi|188586014|ref|YP_001917559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]