SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188586431|ref|YP_001917976.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188586431|ref|YP_001917976.1|
Domain Number 1 Region: 206-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.62e-67
Family B3/B4 domain of PheRS, PheT 0.0000082
Further Details:      
 
Domain Number 2 Region: 35-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.14e-47
Family Myf domain 0.004
Further Details:      
 
Domain Number 3 Region: 482-710
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00011
Further Details:      
 
Domain Number 4 Region: 720-817
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.96e-28
Family Anticodon-binding domain of PheRS 0.00028
Further Details:      
 
Domain Number 5 Region: 409-490
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188586431|ref|YP_001917976.1|
Sequence length 819
Comment phenylalanyl-tRNA synthetase subunit beta [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MQVSYNWLCEYLDLDISPQELAEKLTNGGVEVEGIEQLNPDLDDIVVGEVKEVTEHPNGD
KLSVTKVDVGDASDSSELQIVCGAPNVAVGQKVPVALVGSMLPDGFIIESCSIRGERSYG
MICSCEELELLSPEEEEGIMVLDDDAPIGESIVTYLELDDTILEFDLTPNRADCLGMLGV
AREVAALLDIPFHEPEVTDYKQNKTLDEININIEDSNLSERYIGMLIEDINIETSPMWLQ
QKLRSYGIRPINNLVDITNFIMIEYGQPLHAFDYDWIKGKNISVRSAQKDEQIKTLDEKQ
RTLTPQDIVIADEERPIAIAGVMGGYDTEVSLNTNRILLEAASFNNISVRRTANRLNLRS
EASLRFEKGVDPNNTLKAAFRAIDLIEQLDVGKVKIGAADEYPQIRECVEVELRTSRVRA
LTGLDISDDEIKDIFRRLDFDIDGEKSLSNTDSERGLKLTVKVPTRRNDISLEVDLIEEI
ARIYGYDRIPTSMPQGKITQGRKTHSQKVADISRETLLTAGFSEIISYTFISPDDFDRIK
LTEDDQFRTAVPLANPMTKEQSIMRTTMIPSILKILEHNSNHGEKDFQVFEIGKVYFPKE
LPLKELPREQTNLIFGGMGKLTPKTWMEQPGEIDFFHLKGVFELLIERLNLNISDFDFMP
EKHPSFHPTRTATIKYRGERVGLMGEIHPELASEFNLDNAVIAELNFEKIIGSANLFDSY
QPLPKYPAVLRDLAVLVPEDTPEEHVAGKIADTGSGLIENIQLFDLYQGDRIPEGMKSLA
YSISFRDPESTLTDEYVDNIFEEIERRLESELGAKLRKS
Download sequence
Identical sequences B2A5N4
457570.Nther_1816 WP_012448255.1.10671 gi|188586431|ref|YP_001917976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]